Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T6C7

Protein Details
Accession A0A1E4T6C7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-77REKILERRKKNKEFEMKKKQMEBasic
NLS Segment(s)
PositionSequence
61-69ERRKKNKEF
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPMLDRDKFMRCEDLIDQLEECHRSDFFEKAFGKCNIIKQDLTNCLHNARLAADREKILERRKKNKEFEMKKKQMEEEEYGKNGYLKKVIEQEYQKKHKQASDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.32
4 0.3
5 0.28
6 0.23
7 0.26
8 0.23
9 0.22
10 0.15
11 0.13
12 0.15
13 0.17
14 0.19
15 0.16
16 0.23
17 0.24
18 0.24
19 0.3
20 0.28
21 0.31
22 0.3
23 0.35
24 0.32
25 0.33
26 0.32
27 0.28
28 0.32
29 0.35
30 0.35
31 0.32
32 0.27
33 0.25
34 0.25
35 0.23
36 0.18
37 0.13
38 0.14
39 0.14
40 0.15
41 0.15
42 0.15
43 0.17
44 0.19
45 0.22
46 0.27
47 0.33
48 0.39
49 0.48
50 0.58
51 0.65
52 0.69
53 0.74
54 0.77
55 0.79
56 0.82
57 0.83
58 0.81
59 0.77
60 0.74
61 0.68
62 0.62
63 0.57
64 0.51
65 0.45
66 0.42
67 0.38
68 0.35
69 0.33
70 0.3
71 0.27
72 0.24
73 0.22
74 0.19
75 0.22
76 0.29
77 0.33
78 0.38
79 0.46
80 0.53
81 0.6
82 0.67
83 0.7
84 0.68
85 0.68