Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T8S2

Protein Details
Accession A0A1E4T8S2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-32ASLPHPKIVKKHAKKFKRHHSDRYHRVGEABasic
NLS Segment(s)
PositionSequence
8-37PKIVKKHAKKFKRHHSDRYHRVGEAWRKQK
46-46R
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHAKKFKRHHSDRYHRVGEAWRKQKGIDSCVRRRFRGEIREPKIGYGSNKKTRHMMPSGHKAFLVKNVKDLEVLLMHTKTYAAEIAHNVSAKNRVEILAKAKSIGVKVTNPKGRLSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.86
4 0.9
5 0.91
6 0.91
7 0.89
8 0.89
9 0.9
10 0.91
11 0.9
12 0.88
13 0.81
14 0.69
15 0.64
16 0.62
17 0.61
18 0.59
19 0.58
20 0.52
21 0.49
22 0.49
23 0.53
24 0.48
25 0.45
26 0.44
27 0.45
28 0.51
29 0.6
30 0.63
31 0.58
32 0.57
33 0.56
34 0.55
35 0.56
36 0.57
37 0.58
38 0.6
39 0.66
40 0.63
41 0.57
42 0.51
43 0.43
44 0.36
45 0.35
46 0.38
47 0.4
48 0.42
49 0.43
50 0.45
51 0.45
52 0.46
53 0.41
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.36
64 0.25
65 0.27
66 0.28
67 0.28
68 0.28
69 0.28
70 0.2
71 0.13
72 0.14
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.21
90 0.2
91 0.2
92 0.18
93 0.17
94 0.19
95 0.23
96 0.27
97 0.27
98 0.26
99 0.25
100 0.26
101 0.26
102 0.25
103 0.26
104 0.24
105 0.25
106 0.33
107 0.42
108 0.48
109 0.47
110 0.48
111 0.49