Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4STQ8

Protein Details
Accession A0A1E4STQ8   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-57EIEKAEKLKRPNRQNEKQNRQKCILRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
Amino Acid Sequences MGACQMELMLLNQDRSFPNGTDVAESRYELVEIEKAEKLKRPNRQNEKQNRQKCILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.15
5 0.17
6 0.17
7 0.18
8 0.18
9 0.18
10 0.18
11 0.16
12 0.16
13 0.14
14 0.12
15 0.11
16 0.09
17 0.09
18 0.08
19 0.08
20 0.1
21 0.11
22 0.12
23 0.14
24 0.18
25 0.26
26 0.31
27 0.41
28 0.48
29 0.58
30 0.68
31 0.77
32 0.83
33 0.86
34 0.9
35 0.91
36 0.9
37 0.86