Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T4F5

Protein Details
Accession A0A1E4T4F5   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-42GGLLWKKPWRLSRPQKYRQRKRLQQVDSNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, mito_nucl 14, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRSTLVNFGGLLWKKPWRLSRPQKYRQRKRLQQVDSNIENLYNGLVANNLSAKRISHLMFNFPKEKDMDPKDKYTVFDKHSRGYRKGVHFVPKWTRLSLRKNPENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.28
5 0.28
6 0.34
7 0.43
8 0.41
9 0.51
10 0.6
11 0.68
12 0.74
13 0.82
14 0.86
15 0.89
16 0.93
17 0.93
18 0.93
19 0.91
20 0.91
21 0.9
22 0.86
23 0.83
24 0.79
25 0.75
26 0.66
27 0.58
28 0.47
29 0.37
30 0.3
31 0.21
32 0.14
33 0.07
34 0.05
35 0.03
36 0.04
37 0.04
38 0.04
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.11
46 0.11
47 0.14
48 0.15
49 0.22
50 0.25
51 0.28
52 0.31
53 0.29
54 0.3
55 0.27
56 0.28
57 0.29
58 0.32
59 0.38
60 0.37
61 0.41
62 0.43
63 0.42
64 0.43
65 0.4
66 0.4
67 0.36
68 0.41
69 0.4
70 0.43
71 0.49
72 0.53
73 0.51
74 0.52
75 0.56
76 0.55
77 0.59
78 0.59
79 0.6
80 0.57
81 0.62
82 0.64
83 0.64
84 0.6
85 0.56
86 0.58
87 0.57
88 0.64
89 0.65
90 0.67