Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T8D0

Protein Details
Accession A0A1E4T8D0    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPNRNHKHKQNRSTGVDLSHydrophilic
26-45GSAKIKKKMRDISRLLKRDNHydrophilic
78-97ATRYHKIKFFERKKATRRYLHydrophilic
NLS Segment(s)
PositionSequence
83-93KIKFFERKKAT
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPPNRNHKHKQNRSTGVDLSTTISLGSAKIKKKMRDISRLLKRDNLPSAVRIENERALKALTLELENVQLNLKAKKLATRYHKIKFFERKKATRRYLQAKKEYDELEKKQTDEQNKGETADSTILKELKKEIKKQRKVLRHAEIDLVYVLNFSKTEKYVSLYPSDSTEDKKELDEKAKKGLMETEKKRQEYKKKFAELMDAGELEVSIEDGLKGMRNSKVELKNQRAIDDMDEVSKDVEQGGDNESGNDDDFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.65
4 0.56
5 0.46
6 0.38
7 0.29
8 0.22
9 0.16
10 0.13
11 0.11
12 0.1
13 0.16
14 0.2
15 0.24
16 0.32
17 0.4
18 0.45
19 0.54
20 0.63
21 0.65
22 0.68
23 0.73
24 0.75
25 0.79
26 0.8
27 0.73
28 0.71
29 0.66
30 0.63
31 0.59
32 0.54
33 0.45
34 0.4
35 0.42
36 0.36
37 0.34
38 0.3
39 0.28
40 0.29
41 0.29
42 0.27
43 0.23
44 0.21
45 0.2
46 0.18
47 0.16
48 0.12
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.13
58 0.13
59 0.14
60 0.14
61 0.15
62 0.2
63 0.24
64 0.3
65 0.36
66 0.45
67 0.52
68 0.57
69 0.62
70 0.6
71 0.65
72 0.68
73 0.68
74 0.69
75 0.7
76 0.72
77 0.74
78 0.81
79 0.79
80 0.76
81 0.76
82 0.76
83 0.76
84 0.76
85 0.76
86 0.7
87 0.65
88 0.62
89 0.55
90 0.51
91 0.48
92 0.43
93 0.41
94 0.38
95 0.37
96 0.38
97 0.4
98 0.38
99 0.37
100 0.36
101 0.33
102 0.32
103 0.32
104 0.27
105 0.23
106 0.2
107 0.17
108 0.15
109 0.11
110 0.12
111 0.13
112 0.13
113 0.13
114 0.15
115 0.21
116 0.25
117 0.33
118 0.43
119 0.52
120 0.6
121 0.68
122 0.74
123 0.75
124 0.77
125 0.78
126 0.75
127 0.68
128 0.61
129 0.55
130 0.47
131 0.38
132 0.31
133 0.22
134 0.13
135 0.09
136 0.08
137 0.05
138 0.05
139 0.05
140 0.07
141 0.08
142 0.1
143 0.1
144 0.13
145 0.16
146 0.18
147 0.2
148 0.19
149 0.19
150 0.19
151 0.22
152 0.2
153 0.19
154 0.2
155 0.19
156 0.19
157 0.2
158 0.21
159 0.22
160 0.3
161 0.34
162 0.33
163 0.38
164 0.4
165 0.38
166 0.36
167 0.4
168 0.39
169 0.42
170 0.46
171 0.49
172 0.54
173 0.57
174 0.63
175 0.65
176 0.67
177 0.68
178 0.72
179 0.72
180 0.71
181 0.72
182 0.66
183 0.65
184 0.56
185 0.49
186 0.41
187 0.31
188 0.25
189 0.21
190 0.2
191 0.12
192 0.1
193 0.06
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.08
200 0.08
201 0.12
202 0.16
203 0.18
204 0.22
205 0.31
206 0.38
207 0.45
208 0.54
209 0.58
210 0.62
211 0.62
212 0.59
213 0.53
214 0.47
215 0.4
216 0.34
217 0.27
218 0.22
219 0.21
220 0.2
221 0.18
222 0.16
223 0.14
224 0.1
225 0.1
226 0.09
227 0.1
228 0.13
229 0.15
230 0.15
231 0.15
232 0.16
233 0.16
234 0.16