Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SUW9

Protein Details
Accession A0A1E4SUW9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-176IKNNKTTNVQERKQKKPRRGKITNTHMKGIHydrophilic
NLS Segment(s)
PositionSequence
158-167RKQKKPRRGK
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
Amino Acid Sequences MKIKFDSKLIKCLSNVDRIKYDPINKTLEYLSLHNIKTASDLLKVLENQPTFQGLPVKQLKDGWNGCLDTIAKLERENKIIVHKTKKENSPRHIWLNKGNYPIGGDKLIEPEFYEMWSKVKVPKGDELAIQLLKNGLKPTNVDLENIKNNKTTNVQERKQKKPRRGKITNTHMKGILKDYSSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.44
4 0.44
5 0.43
6 0.48
7 0.46
8 0.49
9 0.45
10 0.46
11 0.47
12 0.43
13 0.43
14 0.38
15 0.35
16 0.3
17 0.26
18 0.26
19 0.27
20 0.27
21 0.26
22 0.26
23 0.22
24 0.22
25 0.23
26 0.19
27 0.14
28 0.15
29 0.14
30 0.17
31 0.18
32 0.18
33 0.21
34 0.2
35 0.19
36 0.2
37 0.21
38 0.18
39 0.18
40 0.22
41 0.16
42 0.24
43 0.29
44 0.29
45 0.28
46 0.31
47 0.32
48 0.35
49 0.35
50 0.29
51 0.27
52 0.26
53 0.25
54 0.24
55 0.22
56 0.14
57 0.15
58 0.14
59 0.1
60 0.12
61 0.16
62 0.15
63 0.17
64 0.17
65 0.17
66 0.22
67 0.28
68 0.32
69 0.36
70 0.41
71 0.45
72 0.51
73 0.58
74 0.61
75 0.63
76 0.62
77 0.63
78 0.61
79 0.63
80 0.59
81 0.53
82 0.51
83 0.5
84 0.48
85 0.43
86 0.38
87 0.3
88 0.29
89 0.28
90 0.22
91 0.15
92 0.12
93 0.1
94 0.13
95 0.13
96 0.11
97 0.11
98 0.11
99 0.1
100 0.11
101 0.13
102 0.09
103 0.11
104 0.12
105 0.12
106 0.16
107 0.21
108 0.23
109 0.24
110 0.29
111 0.32
112 0.32
113 0.32
114 0.3
115 0.28
116 0.26
117 0.23
118 0.18
119 0.16
120 0.15
121 0.16
122 0.15
123 0.13
124 0.13
125 0.15
126 0.18
127 0.24
128 0.24
129 0.23
130 0.24
131 0.28
132 0.36
133 0.37
134 0.35
135 0.3
136 0.3
137 0.32
138 0.34
139 0.35
140 0.37
141 0.45
142 0.49
143 0.57
144 0.64
145 0.72
146 0.78
147 0.8
148 0.8
149 0.82
150 0.87
151 0.88
152 0.89
153 0.89
154 0.89
155 0.91
156 0.91
157 0.85
158 0.78
159 0.72
160 0.64
161 0.56
162 0.5
163 0.44
164 0.36