Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T5R3

Protein Details
Accession A0A1E4T5R3   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-47KKWIEERKKNWPTDKRIQARKEBasic
68-93QSNSNKRICKFWQKNKKCRHGSSCKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019496  NUFIP1_cons_dom  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF10453  NUFIP1  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MSPSLSTKVIPIQGTNIVLESEEDIKKWIEERKKNWPTDKRIQARKEELEREQKLMKTMTPSSSSTNQSNSNKRICKFWQKNKKCRHGSSCKFLHSVDGDDTTTTGTTTSDNSNTQQHKIMRNLPNHKLQSIHGIPVQVPKRFTPSINKGKSLHNLLVESERLNNENMVLLDVFKKIMASGLVVTNWDVLKEKIQSDQVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.21
4 0.16
5 0.15
6 0.15
7 0.13
8 0.15
9 0.14
10 0.14
11 0.15
12 0.15
13 0.16
14 0.19
15 0.25
16 0.3
17 0.39
18 0.45
19 0.55
20 0.63
21 0.7
22 0.76
23 0.78
24 0.77
25 0.78
26 0.83
27 0.81
28 0.81
29 0.79
30 0.78
31 0.76
32 0.75
33 0.72
34 0.67
35 0.64
36 0.65
37 0.62
38 0.57
39 0.53
40 0.46
41 0.42
42 0.37
43 0.32
44 0.27
45 0.28
46 0.27
47 0.27
48 0.27
49 0.29
50 0.32
51 0.34
52 0.31
53 0.31
54 0.36
55 0.39
56 0.45
57 0.45
58 0.48
59 0.5
60 0.49
61 0.52
62 0.5
63 0.55
64 0.58
65 0.63
66 0.66
67 0.71
68 0.8
69 0.84
70 0.89
71 0.86
72 0.83
73 0.82
74 0.81
75 0.77
76 0.76
77 0.71
78 0.63
79 0.56
80 0.49
81 0.42
82 0.32
83 0.27
84 0.2
85 0.16
86 0.13
87 0.12
88 0.12
89 0.09
90 0.08
91 0.06
92 0.05
93 0.04
94 0.05
95 0.06
96 0.08
97 0.09
98 0.11
99 0.12
100 0.19
101 0.21
102 0.22
103 0.26
104 0.28
105 0.31
106 0.34
107 0.42
108 0.42
109 0.49
110 0.54
111 0.53
112 0.58
113 0.55
114 0.51
115 0.44
116 0.38
117 0.38
118 0.32
119 0.3
120 0.22
121 0.22
122 0.21
123 0.28
124 0.31
125 0.25
126 0.26
127 0.24
128 0.3
129 0.3
130 0.32
131 0.34
132 0.4
133 0.48
134 0.5
135 0.54
136 0.49
137 0.53
138 0.57
139 0.53
140 0.46
141 0.39
142 0.36
143 0.33
144 0.33
145 0.29
146 0.24
147 0.21
148 0.19
149 0.17
150 0.17
151 0.16
152 0.13
153 0.14
154 0.14
155 0.12
156 0.11
157 0.11
158 0.11
159 0.12
160 0.12
161 0.09
162 0.09
163 0.07
164 0.09
165 0.09
166 0.09
167 0.1
168 0.12
169 0.12
170 0.13
171 0.14
172 0.15
173 0.14
174 0.14
175 0.14
176 0.13
177 0.18
178 0.21
179 0.22
180 0.24