Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SXJ6

Protein Details
Accession A0A1E4SXJ6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-85QNITLSIKKNPKRQKEKTKTKTKTKEQSLTQNLKVHydrophilic
NLS Segment(s)
PositionSequence
58-73KKNPKRQKEKTKTKTK
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MCVAKVVACYSKQTHPYVVYILLSIIIQRELTMLFSFNSPNEIYQRKKNLQNITLSIKKNPKRQKEKTKTKTKTKEQSLTQNLKVIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.36
4 0.33
5 0.31
6 0.24
7 0.19
8 0.16
9 0.12
10 0.1
11 0.08
12 0.07
13 0.06
14 0.05
15 0.05
16 0.06
17 0.05
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.08
24 0.08
25 0.1
26 0.09
27 0.1
28 0.12
29 0.16
30 0.19
31 0.24
32 0.32
33 0.34
34 0.4
35 0.46
36 0.49
37 0.49
38 0.5
39 0.48
40 0.47
41 0.49
42 0.44
43 0.43
44 0.46
45 0.48
46 0.54
47 0.6
48 0.64
49 0.68
50 0.77
51 0.83
52 0.85
53 0.91
54 0.92
55 0.94
56 0.92
57 0.93
58 0.93
59 0.92
60 0.91
61 0.9
62 0.88
63 0.84
64 0.85
65 0.84
66 0.81
67 0.74