Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T4C8

Protein Details
Accession A0A1E4T4C8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-55GGEDGKSQKKKKRTSHLIDLEMHydrophilic
NLS Segment(s)
PositionSequence
43-44KK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
IPR038846  RPC9  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0000166  F:nucleotide binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MKIEVSRDNLLSNFEVYEHLKLIQSENNWNFTLGGEDGKSQKKKKRTSHLIDLEMITRDLSNYLVKTGSSNTTNVNSVVQLMLGLNQYSLEKIEKLEILNSLPRSIVTLYSIIEECDQRFSGEDCEAILALVQENFPLPDDEQIIDQDEGEELDASNMDIDEEEVQGDYYGEDIVEEEFEQETYTRKTGDEVTIED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.18
5 0.16
6 0.16
7 0.17
8 0.17
9 0.2
10 0.21
11 0.22
12 0.3
13 0.31
14 0.34
15 0.33
16 0.33
17 0.3
18 0.26
19 0.25
20 0.16
21 0.15
22 0.12
23 0.13
24 0.17
25 0.25
26 0.32
27 0.37
28 0.44
29 0.52
30 0.61
31 0.69
32 0.75
33 0.78
34 0.8
35 0.84
36 0.84
37 0.78
38 0.7
39 0.61
40 0.52
41 0.42
42 0.33
43 0.22
44 0.14
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.1
53 0.1
54 0.12
55 0.14
56 0.13
57 0.14
58 0.15
59 0.16
60 0.17
61 0.17
62 0.15
63 0.12
64 0.11
65 0.1
66 0.08
67 0.06
68 0.05
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.08
83 0.09
84 0.09
85 0.09
86 0.12
87 0.12
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.07
95 0.08
96 0.08
97 0.09
98 0.09
99 0.08
100 0.09
101 0.09
102 0.09
103 0.1
104 0.1
105 0.09
106 0.1
107 0.11
108 0.12
109 0.12
110 0.12
111 0.09
112 0.09
113 0.09
114 0.08
115 0.07
116 0.05
117 0.04
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.08
127 0.1
128 0.1
129 0.11
130 0.12
131 0.14
132 0.12
133 0.12
134 0.1
135 0.09
136 0.08
137 0.08
138 0.08
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.08
168 0.08
169 0.12
170 0.15
171 0.16
172 0.16
173 0.16
174 0.19
175 0.22
176 0.27