Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T5E7

Protein Details
Accession A0A1E4T5E7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
92-121IEAEKPTKKKFNKLKKSKKVNNEVSKRQKLHydrophilic
NLS Segment(s)
PositionSequence
95-112EKPTKKKFNKLKKSKKVN
Subcellular Location(s) plas 8, mito 4, pero 4, E.R. 4, nucl 3, golg 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036286  LexA/Signal_pep-like_sf  
IPR019756  Pept_S26A_signal_pept_1_Ser-AS  
IPR015927  Peptidase_S24_S26A/B/C  
IPR019533  Peptidase_S26  
IPR001733  Peptidase_S26B  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF00717  Peptidase_S24  
PROSITE View protein in PROSITE  
PS00501  SPASE_I_1  
CDD cd06530  S26_SPase_I  
Amino Acid Sequences MNLRLQLNQGLNMAMVLASAFAFWKLLSVIAMSNSPIVVVLSGSMEPAFQRGDILFLWNREEYLNVGDIVVYKIQDKEIPIVHRIVREHKVIEAEKPTKKKFNKLKKSKKVNNEVSKRQKLLTKGDNNERDDLPLYAYGQQYLDRSKDILGSVKGYVPKVGYVTILITENVYFKYAMVGILALSALIQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.09
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.12
42 0.13
43 0.13
44 0.16
45 0.15
46 0.16
47 0.14
48 0.14
49 0.11
50 0.11
51 0.11
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.1
64 0.11
65 0.15
66 0.16
67 0.17
68 0.19
69 0.2
70 0.21
71 0.22
72 0.24
73 0.24
74 0.23
75 0.22
76 0.21
77 0.24
78 0.22
79 0.23
80 0.24
81 0.27
82 0.29
83 0.34
84 0.36
85 0.4
86 0.42
87 0.49
88 0.53
89 0.59
90 0.65
91 0.71
92 0.8
93 0.82
94 0.91
95 0.9
96 0.89
97 0.88
98 0.87
99 0.86
100 0.83
101 0.83
102 0.82
103 0.8
104 0.71
105 0.63
106 0.57
107 0.51
108 0.5
109 0.5
110 0.48
111 0.48
112 0.56
113 0.61
114 0.59
115 0.58
116 0.5
117 0.43
118 0.35
119 0.3
120 0.22
121 0.16
122 0.15
123 0.15
124 0.15
125 0.14
126 0.13
127 0.15
128 0.15
129 0.17
130 0.17
131 0.14
132 0.15
133 0.15
134 0.16
135 0.16
136 0.19
137 0.17
138 0.18
139 0.18
140 0.21
141 0.23
142 0.22
143 0.22
144 0.18
145 0.18
146 0.17
147 0.17
148 0.14
149 0.12
150 0.12
151 0.12
152 0.13
153 0.11
154 0.11
155 0.11
156 0.12
157 0.11
158 0.12
159 0.1
160 0.09
161 0.11
162 0.11
163 0.11
164 0.1
165 0.09
166 0.08
167 0.08
168 0.08
169 0.05
170 0.04