Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SY33

Protein Details
Accession A0A1E4SY33    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-28LYYTFFKRFKKVKKSDIVKLIDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.831, nucl 11.5, cyto_nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022535  Golgi_pH-regulator_cons_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12537  GPHR_N  
Amino Acid Sequences MGTISSLYYTFFKRFKKVKKSDIVKLIDTLKATDNLIDLRIQELQVNGGDSNDLKNELKALKQMKLDLIQDLSYLLNNYKMQLQSLRLIGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.62
4 0.68
5 0.73
6 0.78
7 0.81
8 0.81
9 0.81
10 0.74
11 0.64
12 0.58
13 0.51
14 0.42
15 0.35
16 0.28
17 0.21
18 0.17
19 0.16
20 0.13
21 0.12
22 0.1
23 0.11
24 0.1
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.08
31 0.08
32 0.07
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.07
42 0.07
43 0.1
44 0.11
45 0.12
46 0.17
47 0.2
48 0.22
49 0.23
50 0.25
51 0.25
52 0.28
53 0.28
54 0.24
55 0.23
56 0.18
57 0.17
58 0.16
59 0.14
60 0.11
61 0.11
62 0.09
63 0.13
64 0.13
65 0.14
66 0.18
67 0.19
68 0.21
69 0.23
70 0.26
71 0.26
72 0.31