Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SZP7

Protein Details
Accession A0A1E4SZP7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-72ISESLKKPSKKSKKSSGPDSGDHydrophilic
NLS Segment(s)
PositionSequence
57-64KPSKKSKK
Subcellular Location(s) plas 17, E.R. 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009580  GPI_biosynthesis_protein_Pig-F  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06699  PIG-F  
Amino Acid Sequences LNASFYLVPFHMILMIITLFQHFKITEDVQEASRNSFFAILVLQNIYGMMISESLKKPSKKSKKSSGPDSGDYLYLSVATVFTVASAIPLHLILVLLGAPIGSLTIETFYLSSHLSFLTTYPLLIAYKFTSPNAGKKWLRLLTFQVPEFYKNQIYMSVLGSLAGCWLGVMPIPLDWDRDWQAWPITLLVGGYFGSFVGGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.09
6 0.08
7 0.08
8 0.11
9 0.09
10 0.11
11 0.16
12 0.17
13 0.18
14 0.21
15 0.22
16 0.22
17 0.26
18 0.26
19 0.24
20 0.23
21 0.2
22 0.18
23 0.17
24 0.15
25 0.11
26 0.12
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.05
35 0.05
36 0.04
37 0.05
38 0.06
39 0.11
40 0.12
41 0.17
42 0.24
43 0.25
44 0.31
45 0.41
46 0.51
47 0.56
48 0.64
49 0.7
50 0.75
51 0.81
52 0.84
53 0.83
54 0.77
55 0.7
56 0.65
57 0.55
58 0.44
59 0.36
60 0.27
61 0.17
62 0.11
63 0.09
64 0.05
65 0.04
66 0.03
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.08
106 0.08
107 0.08
108 0.07
109 0.09
110 0.08
111 0.09
112 0.1
113 0.08
114 0.1
115 0.11
116 0.11
117 0.17
118 0.18
119 0.24
120 0.27
121 0.34
122 0.32
123 0.34
124 0.42
125 0.4
126 0.41
127 0.37
128 0.39
129 0.39
130 0.42
131 0.4
132 0.36
133 0.32
134 0.33
135 0.32
136 0.29
137 0.23
138 0.19
139 0.19
140 0.17
141 0.18
142 0.17
143 0.17
144 0.15
145 0.13
146 0.12
147 0.11
148 0.1
149 0.08
150 0.07
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.09
160 0.1
161 0.13
162 0.13
163 0.18
164 0.21
165 0.22
166 0.23
167 0.23
168 0.24
169 0.23
170 0.24
171 0.19
172 0.16
173 0.15
174 0.13
175 0.1
176 0.09
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05