Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4STS2

Protein Details
Accession A0A1E4STS2   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
190-209GTGIKKEKRIRDRGLKIQSVHydrophilic
226-249KLTSSNDKGRRGKKGKRGGRGGKYBasic
NLS Segment(s)
PositionSequence
195-200KEKRIR
233-249KGRRGKKGKRGGRGGKY
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAPIVVKFTDKYSPKQLPQQSKDEKKVLKSGKPISLEELKLKKKQLETQQQKQTKSKEDLENELNDHALDRLLSESHILTNTKKDSFSSGASLTLQTLNHENPIGNTRAKTLTNRIRSISSTNSKYGSQPSKLEKMPMSLRKGLIKSRIEKISKYEKDAKDAGIVLSKNKKDEFRNIFDNGVTSITDRIGTGIKKEKRIRDRGLKIQSVGRSTRNGLVISKDEIAKLTSSNDKGRRGKKGKRGGRGGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.6
3 0.66
4 0.68
5 0.7
6 0.75
7 0.76
8 0.77
9 0.79
10 0.78
11 0.74
12 0.68
13 0.72
14 0.69
15 0.65
16 0.65
17 0.64
18 0.63
19 0.62
20 0.58
21 0.55
22 0.53
23 0.49
24 0.48
25 0.5
26 0.48
27 0.49
28 0.52
29 0.51
30 0.51
31 0.56
32 0.58
33 0.61
34 0.65
35 0.7
36 0.76
37 0.78
38 0.78
39 0.77
40 0.72
41 0.69
42 0.66
43 0.64
44 0.61
45 0.59
46 0.59
47 0.56
48 0.52
49 0.45
50 0.39
51 0.31
52 0.22
53 0.19
54 0.13
55 0.09
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.08
64 0.1
65 0.11
66 0.11
67 0.16
68 0.19
69 0.2
70 0.2
71 0.19
72 0.22
73 0.23
74 0.24
75 0.21
76 0.18
77 0.18
78 0.18
79 0.18
80 0.14
81 0.13
82 0.12
83 0.1
84 0.12
85 0.11
86 0.12
87 0.12
88 0.11
89 0.1
90 0.13
91 0.15
92 0.13
93 0.13
94 0.14
95 0.17
96 0.18
97 0.19
98 0.25
99 0.31
100 0.36
101 0.37
102 0.37
103 0.36
104 0.36
105 0.37
106 0.35
107 0.33
108 0.29
109 0.29
110 0.29
111 0.28
112 0.27
113 0.31
114 0.29
115 0.25
116 0.26
117 0.29
118 0.33
119 0.32
120 0.34
121 0.28
122 0.28
123 0.33
124 0.35
125 0.35
126 0.33
127 0.34
128 0.36
129 0.37
130 0.36
131 0.37
132 0.36
133 0.35
134 0.38
135 0.44
136 0.42
137 0.4
138 0.43
139 0.46
140 0.43
141 0.46
142 0.49
143 0.43
144 0.46
145 0.46
146 0.41
147 0.32
148 0.31
149 0.25
150 0.2
151 0.19
152 0.19
153 0.25
154 0.25
155 0.26
156 0.28
157 0.32
158 0.32
159 0.41
160 0.44
161 0.43
162 0.47
163 0.46
164 0.44
165 0.4
166 0.37
167 0.27
168 0.21
169 0.15
170 0.11
171 0.1
172 0.09
173 0.09
174 0.08
175 0.09
176 0.11
177 0.11
178 0.16
179 0.25
180 0.29
181 0.38
182 0.45
183 0.54
184 0.6
185 0.69
186 0.73
187 0.74
188 0.78
189 0.79
190 0.81
191 0.75
192 0.68
193 0.65
194 0.59
195 0.54
196 0.48
197 0.42
198 0.37
199 0.36
200 0.38
201 0.35
202 0.32
203 0.28
204 0.29
205 0.29
206 0.29
207 0.29
208 0.25
209 0.22
210 0.22
211 0.22
212 0.18
213 0.16
214 0.17
215 0.22
216 0.25
217 0.34
218 0.39
219 0.48
220 0.56
221 0.63
222 0.7
223 0.72
224 0.78
225 0.79
226 0.84
227 0.84
228 0.85
229 0.88