Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T6Y8

Protein Details
Accession A0A1E4T6Y8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
78-109MTSVLRKRRLAMKKHKLRKRRKAQRALKIKLGBasic
NLS Segment(s)
PositionSequence
83-109RKRRLAMKKHKLRKRRKAQRALKIKLG
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFKRLSVLPSITKRLASTFTQGPLTRQFPQHIISKITPLQTPSPQSIISQITPRINNNISSPLVEKIDIVENDKEYLMTSVLRKRRLAMKKHKLRKRRKAQRALKIKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.29
4 0.29
5 0.26
6 0.27
7 0.31
8 0.31
9 0.31
10 0.33
11 0.35
12 0.34
13 0.33
14 0.33
15 0.3
16 0.32
17 0.36
18 0.32
19 0.33
20 0.3
21 0.31
22 0.31
23 0.31
24 0.29
25 0.25
26 0.26
27 0.24
28 0.26
29 0.24
30 0.23
31 0.22
32 0.21
33 0.21
34 0.2
35 0.18
36 0.17
37 0.18
38 0.2
39 0.2
40 0.21
41 0.22
42 0.2
43 0.2
44 0.19
45 0.2
46 0.17
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.12
53 0.1
54 0.15
55 0.14
56 0.16
57 0.16
58 0.16
59 0.16
60 0.17
61 0.15
62 0.11
63 0.11
64 0.09
65 0.09
66 0.12
67 0.19
68 0.25
69 0.29
70 0.29
71 0.32
72 0.41
73 0.48
74 0.55
75 0.59
76 0.65
77 0.72
78 0.82
79 0.87
80 0.88
81 0.91
82 0.92
83 0.92
84 0.92
85 0.92
86 0.93
87 0.94
88 0.94
89 0.94