Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SV37

Protein Details
Accession A0A1E4SV37   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-101AIQSARRNKKRSQKRLASKLTDEHydrophilic
NLS Segment(s)
PositionSequence
84-93RRNKKRSQKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007147  TF_Vhr  
Pfam View protein in Pfam  
PF04001  Vhr1  
Amino Acid Sequences KNSVNGTTSLIRKKLDFNDEIQWKRFSSRRLQLVETLSLSSKKASEQDNEIRICAKTLMHEFKFKDSTLPEFDKLVRMAIQSARRNKKRSQKRLASKLTDEPSSKDADIATNSGSHSPTETDLENDNYKRRKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.41
4 0.39
5 0.45
6 0.52
7 0.54
8 0.51
9 0.46
10 0.39
11 0.42
12 0.42
13 0.37
14 0.38
15 0.43
16 0.48
17 0.5
18 0.51
19 0.51
20 0.5
21 0.48
22 0.39
23 0.32
24 0.25
25 0.22
26 0.2
27 0.16
28 0.13
29 0.12
30 0.15
31 0.17
32 0.18
33 0.24
34 0.3
35 0.35
36 0.35
37 0.34
38 0.32
39 0.28
40 0.26
41 0.2
42 0.14
43 0.1
44 0.16
45 0.22
46 0.22
47 0.27
48 0.27
49 0.3
50 0.32
51 0.29
52 0.26
53 0.2
54 0.22
55 0.22
56 0.24
57 0.21
58 0.2
59 0.2
60 0.2
61 0.2
62 0.17
63 0.13
64 0.1
65 0.12
66 0.15
67 0.22
68 0.27
69 0.36
70 0.45
71 0.51
72 0.56
73 0.62
74 0.68
75 0.71
76 0.75
77 0.77
78 0.77
79 0.81
80 0.87
81 0.88
82 0.83
83 0.76
84 0.74
85 0.66
86 0.6
87 0.51
88 0.44
89 0.37
90 0.35
91 0.3
92 0.23
93 0.2
94 0.18
95 0.18
96 0.16
97 0.15
98 0.13
99 0.14
100 0.15
101 0.15
102 0.13
103 0.13
104 0.13
105 0.15
106 0.16
107 0.16
108 0.17
109 0.2
110 0.24
111 0.29
112 0.31
113 0.37
114 0.4