Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4STS8

Protein Details
Accession A0A1E4STS8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-32NINMNKITKKQSKQNKSKRANENDSQFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.666, cyto_nucl 10.166, mito 9
Family & Domain DBs
Amino Acid Sequences MTASNINMNKITKKQSKQNKSKRANENDSQFKLLINTKTSKVTRPQFKFIINTKNLTITKFMNKSERTFTINTKKLTISKGFKNKKKGTLSNCLVCKSDVVNGLITPPLTIQDKLIAARISNNDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.74
4 0.8
5 0.85
6 0.87
7 0.87
8 0.9
9 0.91
10 0.9
11 0.87
12 0.83
13 0.81
14 0.8
15 0.73
16 0.65
17 0.54
18 0.44
19 0.39
20 0.37
21 0.31
22 0.26
23 0.25
24 0.25
25 0.31
26 0.32
27 0.34
28 0.38
29 0.43
30 0.49
31 0.51
32 0.55
33 0.52
34 0.53
35 0.55
36 0.52
37 0.52
38 0.44
39 0.41
40 0.36
41 0.39
42 0.36
43 0.31
44 0.28
45 0.21
46 0.25
47 0.25
48 0.26
49 0.27
50 0.28
51 0.29
52 0.31
53 0.31
54 0.29
55 0.28
56 0.33
57 0.36
58 0.4
59 0.39
60 0.37
61 0.37
62 0.35
63 0.37
64 0.38
65 0.34
66 0.37
67 0.46
68 0.54
69 0.58
70 0.66
71 0.68
72 0.7
73 0.74
74 0.73
75 0.69
76 0.7
77 0.7
78 0.67
79 0.64
80 0.57
81 0.49
82 0.42
83 0.36
84 0.27
85 0.25
86 0.21
87 0.2
88 0.19
89 0.17
90 0.18
91 0.18
92 0.16
93 0.13
94 0.09
95 0.11
96 0.13
97 0.13
98 0.13
99 0.16
100 0.18
101 0.19
102 0.24
103 0.21
104 0.19
105 0.24