Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T125

Protein Details
Accession A0A1E4T125    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-29NKNLKLLLTKKKRKIQIKSNQINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MFFFNDNKNLKLLLTKKKRKIQIKSNQINLKFKIKLMPVVVFCVPNKTRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.62
4 0.69
5 0.78
6 0.79
7 0.81
8 0.81
9 0.81
10 0.82
11 0.79
12 0.8
13 0.76
14 0.71
15 0.67
16 0.59
17 0.55
18 0.45
19 0.39
20 0.36
21 0.32
22 0.33
23 0.3
24 0.33
25 0.27
26 0.3
27 0.31
28 0.28
29 0.27
30 0.31
31 0.29