Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A0HS66

Protein Details
Accession A0A0A0HS66   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-78MKLFSSHKNIKQRKIFQKNKSHRMQDAHydrophilic
NLS Segment(s)
PositionSequence
43-51KREQRKSRF
62-62K
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, mito_nucl 12.666, mito 3.5
Family & Domain DBs
KEGG pbn:PADG_11858  -  
Amino Acid Sequences MTQGSQLQTHGQHNSLSTVNMKPNLQGWDKTHVSRGSLTKMAKREQRKSRFMKLFSSHKNIKQRKIFQKNKSHRMQDADQSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.2
4 0.19
5 0.19
6 0.22
7 0.24
8 0.23
9 0.21
10 0.24
11 0.27
12 0.27
13 0.27
14 0.26
15 0.31
16 0.32
17 0.32
18 0.34
19 0.3
20 0.29
21 0.28
22 0.28
23 0.24
24 0.27
25 0.27
26 0.26
27 0.29
28 0.32
29 0.35
30 0.41
31 0.47
32 0.52
33 0.6
34 0.65
35 0.68
36 0.73
37 0.74
38 0.69
39 0.67
40 0.64
41 0.64
42 0.61
43 0.63
44 0.59
45 0.59
46 0.67
47 0.66
48 0.69
49 0.69
50 0.73
51 0.76
52 0.82
53 0.84
54 0.83
55 0.88
56 0.89
57 0.9
58 0.89
59 0.84
60 0.79
61 0.77
62 0.72