Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4STM4

Protein Details
Accession A0A1E4STM4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-41ELAKIKEERKLKKQKEEEKLNIEBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14.333, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006973  Cwf_Cwc_15  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF04889  Cwf_Cwc_15  
Amino Acid Sequences MMMMMMRNDEDDEELLLQELAKIKEERKLKKQKEEEKLNIENAKISNPLVQIQDDDDEISGSGSGSGKQLKKSWRDQSVFRKQSVKSDDGNGKDRYVNDMLKSDFHKKFMNKYIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.09
6 0.12
7 0.12
8 0.15
9 0.17
10 0.18
11 0.24
12 0.32
13 0.39
14 0.45
15 0.55
16 0.59
17 0.68
18 0.77
19 0.81
20 0.83
21 0.85
22 0.81
23 0.78
24 0.73
25 0.68
26 0.59
27 0.5
28 0.42
29 0.32
30 0.27
31 0.2
32 0.17
33 0.14
34 0.13
35 0.15
36 0.13
37 0.13
38 0.12
39 0.12
40 0.12
41 0.1
42 0.09
43 0.07
44 0.06
45 0.06
46 0.05
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.06
53 0.11
54 0.12
55 0.15
56 0.2
57 0.25
58 0.31
59 0.4
60 0.47
61 0.51
62 0.52
63 0.58
64 0.64
65 0.7
66 0.68
67 0.62
68 0.6
69 0.51
70 0.57
71 0.55
72 0.47
73 0.38
74 0.42
75 0.45
76 0.44
77 0.49
78 0.43
79 0.38
80 0.38
81 0.36
82 0.35
83 0.33
84 0.31
85 0.27
86 0.3
87 0.3
88 0.31
89 0.36
90 0.39
91 0.37
92 0.38
93 0.44
94 0.43
95 0.51