Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T903

Protein Details
Accession A0A1E4T903    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-188IVYTKKLISRKLQQKKHESLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021264  YDR124W-like  
IPR047092  YDR124W-like_helical  
Pfam View protein in Pfam  
PF11001  DUF2841  
Amino Acid Sequences SDPENSEIIRSTYRDIKLNPQEKIDVENYLFQCFEEFQQIPCKLLAKSWIKLIEPKKQTQHPYKKGSESKPFWWPKECRHKEPDHLKKEERIQLLIGMIRQFKHRSLEFITAAELVCENQTFENGKFKRTGHLSKRKLDILFEMFKVLNCDKSVDEVSVIKPGKKYSSIVYTKKLISRKLQQKKHESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.44
4 0.51
5 0.57
6 0.54
7 0.5
8 0.5
9 0.45
10 0.48
11 0.39
12 0.32
13 0.26
14 0.31
15 0.29
16 0.27
17 0.26
18 0.21
19 0.21
20 0.18
21 0.17
22 0.17
23 0.17
24 0.17
25 0.26
26 0.27
27 0.27
28 0.27
29 0.28
30 0.21
31 0.22
32 0.29
33 0.26
34 0.27
35 0.3
36 0.33
37 0.31
38 0.39
39 0.42
40 0.43
41 0.42
42 0.47
43 0.48
44 0.52
45 0.59
46 0.63
47 0.69
48 0.68
49 0.71
50 0.7
51 0.72
52 0.73
53 0.72
54 0.71
55 0.65
56 0.6
57 0.62
58 0.62
59 0.56
60 0.56
61 0.53
62 0.52
63 0.59
64 0.62
65 0.58
66 0.6
67 0.62
68 0.63
69 0.71
70 0.71
71 0.67
72 0.67
73 0.62
74 0.59
75 0.61
76 0.58
77 0.48
78 0.38
79 0.31
80 0.26
81 0.25
82 0.21
83 0.15
84 0.11
85 0.1
86 0.1
87 0.13
88 0.13
89 0.14
90 0.18
91 0.18
92 0.2
93 0.22
94 0.27
95 0.25
96 0.23
97 0.22
98 0.18
99 0.18
100 0.14
101 0.11
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.07
108 0.09
109 0.1
110 0.19
111 0.2
112 0.21
113 0.24
114 0.25
115 0.29
116 0.34
117 0.43
118 0.44
119 0.54
120 0.59
121 0.62
122 0.67
123 0.65
124 0.59
125 0.51
126 0.46
127 0.41
128 0.37
129 0.31
130 0.29
131 0.24
132 0.24
133 0.27
134 0.23
135 0.2
136 0.18
137 0.2
138 0.17
139 0.22
140 0.22
141 0.18
142 0.19
143 0.17
144 0.18
145 0.24
146 0.25
147 0.23
148 0.24
149 0.26
150 0.29
151 0.3
152 0.31
153 0.28
154 0.38
155 0.44
156 0.47
157 0.49
158 0.5
159 0.51
160 0.55
161 0.56
162 0.52
163 0.52
164 0.58
165 0.63
166 0.69
167 0.74
168 0.78