Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4T3U7

Protein Details
Accession A0A1E4T3U7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQRKRLAHKKNFKKKACFSFHLHydrophilic
NLS Segment(s)
PositionSequence
5-14RLAHKKNFKK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MQRKRLAHKKNFKKKACFSFHLPLKDAFPKIVPLKPTVGELQHFTVDLIVRTPSCAYISYGEDPYENKASDRDSRAIFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.86
4 0.8
5 0.76
6 0.75
7 0.73
8 0.68
9 0.6
10 0.51
11 0.46
12 0.46
13 0.39
14 0.3
15 0.23
16 0.24
17 0.25
18 0.26
19 0.24
20 0.21
21 0.22
22 0.22
23 0.23
24 0.19
25 0.17
26 0.15
27 0.15
28 0.15
29 0.13
30 0.13
31 0.11
32 0.1
33 0.1
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.12
45 0.16
46 0.18
47 0.2
48 0.19
49 0.19
50 0.19
51 0.22
52 0.24
53 0.21
54 0.18
55 0.19
56 0.23
57 0.3
58 0.34
59 0.34