Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T8W9

Protein Details
Accession A0A1E4T8W9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MNKQQKKPQITKLKPTKQNINPKKPKSKSSPAPPSSHydrophilic
NLS Segment(s)
PositionSequence
12-29KLKPTKQNINPKKPKSKS
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MNKQQKKPQITKLKPTKQNINPKKPKSKSSPAPPSSSTTSLKQFEQKKKTIFKPILTNPYTKQNTWPIITPDLASGLQDMLCESILNEIGKYNTLTATERKKLNIKQPESAKYVTSGFNSVTSKLEKQSRRIQAQGLSNIENDPNTVVALFVCKLDLTNPIMYAHFPMLAALSHVKLIQLPRNSSKRLQTALGLSTKVTILCLSKGLFMDSIPGGSVSGSRKALGDILKSSVPDAETPGFMRGVGFADSVKFLLTEQNISVNKGTKKKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.84
5 0.87
6 0.87
7 0.87
8 0.87
9 0.88
10 0.92
11 0.87
12 0.87
13 0.85
14 0.85
15 0.83
16 0.84
17 0.85
18 0.79
19 0.79
20 0.72
21 0.68
22 0.63
23 0.58
24 0.5
25 0.43
26 0.45
27 0.42
28 0.42
29 0.44
30 0.48
31 0.53
32 0.58
33 0.61
34 0.62
35 0.69
36 0.72
37 0.75
38 0.71
39 0.67
40 0.68
41 0.69
42 0.7
43 0.64
44 0.61
45 0.52
46 0.57
47 0.55
48 0.46
49 0.43
50 0.41
51 0.43
52 0.42
53 0.43
54 0.36
55 0.35
56 0.35
57 0.3
58 0.22
59 0.2
60 0.18
61 0.15
62 0.11
63 0.09
64 0.08
65 0.08
66 0.07
67 0.05
68 0.06
69 0.05
70 0.05
71 0.06
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.1
78 0.1
79 0.09
80 0.08
81 0.09
82 0.11
83 0.16
84 0.22
85 0.26
86 0.27
87 0.3
88 0.36
89 0.4
90 0.47
91 0.52
92 0.49
93 0.51
94 0.55
95 0.58
96 0.55
97 0.5
98 0.41
99 0.33
100 0.31
101 0.26
102 0.21
103 0.17
104 0.13
105 0.15
106 0.16
107 0.15
108 0.15
109 0.15
110 0.15
111 0.18
112 0.25
113 0.25
114 0.29
115 0.38
116 0.43
117 0.44
118 0.45
119 0.44
120 0.41
121 0.42
122 0.41
123 0.34
124 0.27
125 0.24
126 0.23
127 0.21
128 0.16
129 0.12
130 0.08
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.08
144 0.1
145 0.1
146 0.11
147 0.12
148 0.12
149 0.12
150 0.13
151 0.11
152 0.08
153 0.07
154 0.07
155 0.06
156 0.06
157 0.07
158 0.07
159 0.06
160 0.07
161 0.07
162 0.07
163 0.08
164 0.11
165 0.16
166 0.2
167 0.24
168 0.31
169 0.36
170 0.4
171 0.42
172 0.45
173 0.44
174 0.43
175 0.4
176 0.35
177 0.32
178 0.33
179 0.31
180 0.25
181 0.2
182 0.18
183 0.17
184 0.15
185 0.12
186 0.1
187 0.09
188 0.09
189 0.11
190 0.11
191 0.13
192 0.13
193 0.14
194 0.13
195 0.11
196 0.14
197 0.12
198 0.11
199 0.09
200 0.09
201 0.08
202 0.08
203 0.11
204 0.1
205 0.15
206 0.15
207 0.16
208 0.16
209 0.17
210 0.2
211 0.2
212 0.21
213 0.18
214 0.21
215 0.21
216 0.21
217 0.21
218 0.19
219 0.17
220 0.15
221 0.17
222 0.16
223 0.16
224 0.17
225 0.19
226 0.17
227 0.16
228 0.15
229 0.12
230 0.12
231 0.12
232 0.11
233 0.1
234 0.11
235 0.12
236 0.12
237 0.11
238 0.09
239 0.08
240 0.14
241 0.15
242 0.17
243 0.16
244 0.25
245 0.25
246 0.28
247 0.31
248 0.32
249 0.37
250 0.43