Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4STT2

Protein Details
Accession A0A1E4STT2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-43VTLQKRSSKKDKTVSNNNKSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 3, cyto 1, plas 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Amino Acid Sequences SQITIPDLRFQESFKRTLQANAVTLQKRSSKKDKTVSNNNKSNSNSNSNSLTVQQDDDDDDDEELPPISTSVVIYTIIKDQIIMQFVQGFGYALLFLLAKPWLMVAFQSGRSVGSRFIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.31
4 0.34
5 0.38
6 0.33
7 0.31
8 0.31
9 0.36
10 0.34
11 0.34
12 0.33
13 0.35
14 0.35
15 0.41
16 0.47
17 0.49
18 0.56
19 0.63
20 0.69
21 0.71
22 0.77
23 0.81
24 0.8
25 0.79
26 0.72
27 0.7
28 0.63
29 0.6
30 0.53
31 0.49
32 0.42
33 0.37
34 0.38
35 0.33
36 0.31
37 0.26
38 0.23
39 0.16
40 0.14
41 0.12
42 0.1
43 0.1
44 0.09
45 0.09
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.08
64 0.09
65 0.09
66 0.08
67 0.09
68 0.1
69 0.12
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.07
77 0.06
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.04
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.1
93 0.13
94 0.14
95 0.16
96 0.16
97 0.17
98 0.18
99 0.2