Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4SX65

Protein Details
Accession A0A1E4SX65   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
69-90NIAKMKVKEKKLKNSHIRKNIAHydrophilic
143-164NSETGKRRKVRASKVKKMEFNAHydrophilic
NLS Segment(s)
PositionSequence
67-87KHNIAKMKVKEKKLKNSHIRK
146-168TGKRRKVRASKVKKMEFNARLKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MSGFQSSQSKAQTESTVNKLLANFLPGSASVITTTSTSAFDLSGQLSSGAAKISQMSKNLKSLRENKHNIAKMKVKEKKLKNSHIRKNIALQSKITKLSKLQTGSKEATQQLVDQNLKSLKSWENGNQTDLKQLQSKVLRMKNSETGKRRKVRASKVKKMEFNARLKKGHISVPGLTPGLAPVGASDDESASESDLDVDSDEDDNIPILKDDYDDYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.39
4 0.38
5 0.37
6 0.34
7 0.33
8 0.29
9 0.26
10 0.21
11 0.15
12 0.16
13 0.14
14 0.16
15 0.13
16 0.12
17 0.09
18 0.1
19 0.1
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.07
40 0.12
41 0.14
42 0.19
43 0.24
44 0.26
45 0.34
46 0.38
47 0.4
48 0.43
49 0.5
50 0.54
51 0.59
52 0.62
53 0.61
54 0.66
55 0.68
56 0.63
57 0.6
58 0.58
59 0.53
60 0.58
61 0.6
62 0.59
63 0.62
64 0.67
65 0.72
66 0.73
67 0.78
68 0.78
69 0.82
70 0.83
71 0.84
72 0.8
73 0.71
74 0.68
75 0.65
76 0.61
77 0.52
78 0.44
79 0.38
80 0.37
81 0.4
82 0.34
83 0.28
84 0.22
85 0.24
86 0.27
87 0.27
88 0.28
89 0.26
90 0.31
91 0.32
92 0.31
93 0.31
94 0.27
95 0.25
96 0.21
97 0.19
98 0.15
99 0.18
100 0.18
101 0.14
102 0.16
103 0.16
104 0.16
105 0.16
106 0.17
107 0.15
108 0.16
109 0.19
110 0.21
111 0.28
112 0.28
113 0.3
114 0.3
115 0.28
116 0.31
117 0.29
118 0.26
119 0.21
120 0.21
121 0.25
122 0.25
123 0.29
124 0.32
125 0.36
126 0.38
127 0.37
128 0.4
129 0.43
130 0.46
131 0.51
132 0.51
133 0.56
134 0.62
135 0.66
136 0.68
137 0.68
138 0.71
139 0.73
140 0.76
141 0.78
142 0.78
143 0.82
144 0.84
145 0.8
146 0.76
147 0.76
148 0.73
149 0.73
150 0.72
151 0.68
152 0.62
153 0.58
154 0.59
155 0.51
156 0.48
157 0.43
158 0.37
159 0.34
160 0.34
161 0.35
162 0.3
163 0.28
164 0.22
165 0.17
166 0.14
167 0.11
168 0.08
169 0.05
170 0.08
171 0.08
172 0.09
173 0.09
174 0.08
175 0.09
176 0.11
177 0.11
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.08
186 0.08
187 0.09
188 0.09
189 0.08
190 0.08
191 0.09
192 0.09
193 0.09
194 0.08
195 0.09
196 0.09
197 0.09