Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T8B2

Protein Details
Accession A0A1E4T8B2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MFNKQEERKAKQKIHKRQKQQNISTKINSHydrophilic
NLS Segment(s)
PositionSequence
11-13KQK
Subcellular Location(s) nucl 20, cyto 5.5, cyto_pero 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF12622  NpwBP  
Amino Acid Sequences MFNKQEERKAKQKIHKRQKQQNISTKINSIIERYHTSTNLKRKINQIESRENLTISDKKYLETLKSNYILLKNHEDKNKPTSIAKDEQLPKVQTQIQREPRTTKEPKKLYTKSIYYDPELNPLGITPSNPIDETINLPDLLKPTNENKGGTIIIKSNINEPDSIIWPDEDMPKFFKIRDTKLKTTYSGTGTVNQPTVLLPLPPSNASAARFVPRVLMGMKKKVTMPVPVPVPVPVDEVDEVSEQDQFANMAEEEEEYWKERNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.9
4 0.91
5 0.92
6 0.93
7 0.93
8 0.92
9 0.89
10 0.86
11 0.79
12 0.71
13 0.64
14 0.57
15 0.48
16 0.4
17 0.35
18 0.33
19 0.35
20 0.35
21 0.34
22 0.33
23 0.38
24 0.43
25 0.5
26 0.53
27 0.53
28 0.54
29 0.59
30 0.66
31 0.7
32 0.7
33 0.67
34 0.68
35 0.67
36 0.68
37 0.61
38 0.51
39 0.42
40 0.39
41 0.36
42 0.29
43 0.33
44 0.27
45 0.26
46 0.3
47 0.31
48 0.3
49 0.32
50 0.33
51 0.31
52 0.33
53 0.33
54 0.32
55 0.33
56 0.32
57 0.29
58 0.35
59 0.35
60 0.39
61 0.45
62 0.45
63 0.46
64 0.5
65 0.49
66 0.42
67 0.39
68 0.38
69 0.38
70 0.39
71 0.36
72 0.38
73 0.39
74 0.41
75 0.44
76 0.4
77 0.34
78 0.34
79 0.38
80 0.33
81 0.35
82 0.41
83 0.45
84 0.49
85 0.51
86 0.52
87 0.51
88 0.56
89 0.58
90 0.57
91 0.57
92 0.59
93 0.62
94 0.67
95 0.67
96 0.64
97 0.63
98 0.57
99 0.5
100 0.5
101 0.47
102 0.39
103 0.4
104 0.34
105 0.31
106 0.28
107 0.25
108 0.18
109 0.16
110 0.15
111 0.1
112 0.1
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.11
121 0.1
122 0.1
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.09
129 0.1
130 0.11
131 0.18
132 0.19
133 0.19
134 0.19
135 0.2
136 0.2
137 0.19
138 0.17
139 0.12
140 0.12
141 0.14
142 0.13
143 0.16
144 0.17
145 0.17
146 0.16
147 0.15
148 0.16
149 0.16
150 0.17
151 0.13
152 0.11
153 0.1
154 0.12
155 0.17
156 0.15
157 0.15
158 0.16
159 0.18
160 0.19
161 0.19
162 0.25
163 0.25
164 0.32
165 0.42
166 0.48
167 0.52
168 0.57
169 0.6
170 0.54
171 0.52
172 0.49
173 0.41
174 0.36
175 0.31
176 0.29
177 0.29
178 0.29
179 0.26
180 0.21
181 0.19
182 0.15
183 0.16
184 0.12
185 0.1
186 0.09
187 0.11
188 0.13
189 0.13
190 0.14
191 0.14
192 0.16
193 0.17
194 0.18
195 0.18
196 0.2
197 0.2
198 0.19
199 0.19
200 0.17
201 0.18
202 0.17
203 0.23
204 0.24
205 0.32
206 0.33
207 0.33
208 0.34
209 0.38
210 0.39
211 0.38
212 0.36
213 0.35
214 0.37
215 0.36
216 0.36
217 0.32
218 0.31
219 0.25
220 0.25
221 0.18
222 0.18
223 0.17
224 0.17
225 0.17
226 0.15
227 0.15
228 0.13
229 0.14
230 0.1
231 0.1
232 0.1
233 0.08
234 0.08
235 0.1
236 0.09
237 0.09
238 0.09
239 0.1
240 0.11
241 0.14
242 0.15
243 0.15
244 0.17