Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GDA8

Protein Details
Accession C1GDA8   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-56VNVPKTRRTYCKSKECKKHTQHKVTQYKAHydrophilic
79-98QTKPVFRKKAKTTKKVVLRLHydrophilic
NLS Segment(s)
PositionSequence
85-89RKKAK
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_05244  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSEYPFPSHRNHASDTTQNTVLIMRQNVNVPKTRRTYCKSKECKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFRKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.48
4 0.42
5 0.38
6 0.34
7 0.29
8 0.25
9 0.23
10 0.21
11 0.17
12 0.18
13 0.23
14 0.27
15 0.29
16 0.35
17 0.34
18 0.38
19 0.43
20 0.47
21 0.5
22 0.51
23 0.59
24 0.61
25 0.69
26 0.72
27 0.76
28 0.81
29 0.81
30 0.86
31 0.85
32 0.87
33 0.86
34 0.86
35 0.84
36 0.84
37 0.85
38 0.78
39 0.76
40 0.69
41 0.63
42 0.55
43 0.49
44 0.39
45 0.3
46 0.29
47 0.28
48 0.27
49 0.24
50 0.3
51 0.33
52 0.37
53 0.41
54 0.45
55 0.42
56 0.49
57 0.56
58 0.54
59 0.56
60 0.55
61 0.56
62 0.55
63 0.58
64 0.5
65 0.46
66 0.43
67 0.38
68 0.41
69 0.43
70 0.44
71 0.39
72 0.47
73 0.53
74 0.6
75 0.68
76 0.7
77 0.71
78 0.74
79 0.8
80 0.79
81 0.77
82 0.74
83 0.68
84 0.65
85 0.62
86 0.56
87 0.51
88 0.48
89 0.42
90 0.36
91 0.33
92 0.33
93 0.36
94 0.42
95 0.44
96 0.48
97 0.57
98 0.64
99 0.69
100 0.67
101 0.61
102 0.56
103 0.52
104 0.5
105 0.5
106 0.51
107 0.52
108 0.55
109 0.52
110 0.5
111 0.49
112 0.42