Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SZ54

Protein Details
Accession A0A1E4SZ54    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAGGKKSKKKWSKGKVKDKAQHLVVHydrophilic
NLS Segment(s)
PositionSequence
4-18GKKSKKKWSKGKVKD
Subcellular Location(s) mito 15, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAGGKKSKKKWSKGKVKDKAQHLVVLDQEKYDRILKDVPTYRYVSVSVLVDRLKIGGSIARVAIRQLEQDGIIKPVLKHSKQYVYTRATAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.92
4 0.9
5 0.86
6 0.83
7 0.73
8 0.66
9 0.56
10 0.48
11 0.41
12 0.37
13 0.3
14 0.22
15 0.2
16 0.17
17 0.18
18 0.19
19 0.15
20 0.14
21 0.18
22 0.18
23 0.26
24 0.31
25 0.31
26 0.31
27 0.33
28 0.31
29 0.28
30 0.28
31 0.2
32 0.16
33 0.14
34 0.11
35 0.1
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.11
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.13
57 0.14
58 0.13
59 0.14
60 0.15
61 0.14
62 0.22
63 0.31
64 0.3
65 0.35
66 0.4
67 0.48
68 0.53
69 0.6
70 0.59
71 0.56