Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4SV84

Protein Details
Accession A0A1E4SV84    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-90EDYFKYKRKMLKKDNVAFCKHNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.166, mito 10, cyto_nucl 9.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLQTRQSIRRLFSTASHQLQSSCKEGTPINLNIFKAGKPTVALKDEEYPEWLWTLLDKEALLNKLKEEDYFKYKRKMLKKDNVAFCKHNNFMEKMKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.43
4 0.41
5 0.37
6 0.35
7 0.37
8 0.36
9 0.31
10 0.24
11 0.2
12 0.21
13 0.21
14 0.23
15 0.25
16 0.25
17 0.27
18 0.29
19 0.29
20 0.29
21 0.29
22 0.25
23 0.21
24 0.18
25 0.14
26 0.12
27 0.15
28 0.16
29 0.17
30 0.18
31 0.17
32 0.2
33 0.21
34 0.2
35 0.19
36 0.16
37 0.15
38 0.14
39 0.12
40 0.08
41 0.08
42 0.09
43 0.07
44 0.07
45 0.07
46 0.07
47 0.1
48 0.12
49 0.14
50 0.13
51 0.13
52 0.16
53 0.16
54 0.17
55 0.19
56 0.21
57 0.27
58 0.34
59 0.39
60 0.43
61 0.47
62 0.53
63 0.58
64 0.65
65 0.67
66 0.71
67 0.77
68 0.8
69 0.86
70 0.84
71 0.81
72 0.74
73 0.7
74 0.67
75 0.6
76 0.56
77 0.5
78 0.48