Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4T1M4

Protein Details
Accession A0A1E4T1M4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-83WERINRKRALSMSKKRKKRKBasic
NLS Segment(s)
PositionSequence
69-83RKRALSMSKKRKKRK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
Amino Acid Sequences ITADDYETEELYCVCRGPSTGRMIACDNPTCKYEWFHYKCVGIYKDPEPNKRWFCSILCETEYWERINRKRALSMSKKRKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.14
5 0.2
6 0.24
7 0.27
8 0.27
9 0.3
10 0.32
11 0.34
12 0.33
13 0.31
14 0.27
15 0.24
16 0.25
17 0.24
18 0.23
19 0.22
20 0.23
21 0.29
22 0.33
23 0.34
24 0.35
25 0.35
26 0.35
27 0.37
28 0.34
29 0.25
30 0.24
31 0.23
32 0.29
33 0.32
34 0.37
35 0.35
36 0.42
37 0.45
38 0.44
39 0.43
40 0.38
41 0.35
42 0.37
43 0.36
44 0.32
45 0.29
46 0.28
47 0.28
48 0.3
49 0.31
50 0.26
51 0.29
52 0.32
53 0.36
54 0.45
55 0.48
56 0.46
57 0.51
58 0.55
59 0.59
60 0.62
61 0.68
62 0.7
63 0.75