Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4ST26

Protein Details
Accession A0A1E4ST26    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-79PKSGSKEARKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEARKQARKQGRKQGVRBasic
NLS Segment(s)
PositionSequence
29-76GSKEARKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEARKQARKQGRKQ
Subcellular Location(s) nucl 14.5, mito_nucl 11.666, cyto_nucl 10.833, mito 7.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MYSPSIGTTTVHLVYPNKDYTLFIYPKSGSKEARKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEARKQARKQGRKQGVRYLVGAGREVDVSKERLQIKQENCLNMLIGLVVIWDDGLSVPADVKWIQEKDLNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.25
4 0.22
5 0.22
6 0.22
7 0.23
8 0.3
9 0.28
10 0.24
11 0.27
12 0.27
13 0.31
14 0.36
15 0.36
16 0.33
17 0.4
18 0.5
19 0.55
20 0.65
21 0.69
22 0.66
23 0.73
24 0.79
25 0.8
26 0.8
27 0.82
28 0.82
29 0.83
30 0.86
31 0.86
32 0.86
33 0.85
34 0.85
35 0.85
36 0.85
37 0.85
38 0.85
39 0.85
40 0.85
41 0.85
42 0.85
43 0.85
44 0.85
45 0.85
46 0.85
47 0.85
48 0.85
49 0.85
50 0.84
51 0.84
52 0.84
53 0.83
54 0.85
55 0.84
56 0.84
57 0.84
58 0.82
59 0.82
60 0.81
61 0.79
62 0.75
63 0.73
64 0.69
65 0.62
66 0.55
67 0.47
68 0.39
69 0.31
70 0.28
71 0.2
72 0.14
73 0.12
74 0.12
75 0.1
76 0.1
77 0.13
78 0.14
79 0.19
80 0.2
81 0.23
82 0.28
83 0.34
84 0.34
85 0.4
86 0.43
87 0.39
88 0.39
89 0.36
90 0.32
91 0.24
92 0.22
93 0.12
94 0.08
95 0.06
96 0.04
97 0.03
98 0.03
99 0.03
100 0.02
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.08
109 0.08
110 0.11
111 0.17
112 0.18
113 0.21