Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3B5W8

Protein Details
Accession A0A1E3B5W8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-130QLLERNRWWRCKTKRIHCNRDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, plas 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002350  Kazal_dom  
IPR036058  Kazal_dom_sf  
Pfam View protein in Pfam  
PF07648  Kazal_2  
CDD cd00104  KAZAL_FS  
Amino Acid Sequences MQLILATLLLPLLQALPVPVPAPVAGKGIEPVNACRESCPEALAPVCGVNAGGAFEIFDNPCMFDKANCEGLEYVQTDLLECRSLITDDQGAPFKTNRIFHDFLVLVLNQLLERNRWWRCKTKRIHCNRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.08
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.12
15 0.12
16 0.15
17 0.14
18 0.15
19 0.19
20 0.2
21 0.2
22 0.19
23 0.22
24 0.23
25 0.22
26 0.21
27 0.16
28 0.16
29 0.16
30 0.16
31 0.13
32 0.09
33 0.09
34 0.07
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.03
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.05
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.11
53 0.13
54 0.17
55 0.16
56 0.17
57 0.16
58 0.16
59 0.18
60 0.15
61 0.13
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.11
76 0.13
77 0.15
78 0.15
79 0.16
80 0.17
81 0.18
82 0.21
83 0.24
84 0.26
85 0.31
86 0.33
87 0.31
88 0.37
89 0.34
90 0.3
91 0.29
92 0.25
93 0.17
94 0.15
95 0.15
96 0.08
97 0.11
98 0.11
99 0.1
100 0.14
101 0.22
102 0.29
103 0.37
104 0.43
105 0.52
106 0.6
107 0.69
108 0.76
109 0.79
110 0.83