Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BFM8

Protein Details
Accession A0A1E3BFM8    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-39TASPWEPTTPKRPPKRLRPETPKKAIEPHydrophilic
NLS Segment(s)
PositionSequence
22-35KRPPKRLRPETPKK
173-177KAPKS
Subcellular Location(s) nucl 18, cyto 5, pero 3
Family & Domain DBs
Amino Acid Sequences MGEAPGAHETPTASPWEPTTPKRPPKRLRPETPKKAIEPPVIPQNPLRPGQLDQNTHPESPPHGSPQSQLDLELQSHIAAAVASRTAQIKTTGDEVMELVSMVNQKIAKWEERSLQGAASLGKDIRTLVLNFSSNLATGHPAKAENHQPPPSKHNGYAEAAGALPGAPKALPKAPKSPYKSPLPEKPPRIFLRLPTDHPAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.26
4 0.3
5 0.34
6 0.41
7 0.47
8 0.56
9 0.66
10 0.74
11 0.76
12 0.82
13 0.88
14 0.9
15 0.91
16 0.92
17 0.93
18 0.93
19 0.92
20 0.87
21 0.79
22 0.77
23 0.73
24 0.68
25 0.6
26 0.54
27 0.55
28 0.5
29 0.48
30 0.42
31 0.41
32 0.39
33 0.39
34 0.35
35 0.27
36 0.28
37 0.35
38 0.4
39 0.37
40 0.35
41 0.42
42 0.43
43 0.41
44 0.4
45 0.31
46 0.27
47 0.27
48 0.27
49 0.23
50 0.22
51 0.22
52 0.23
53 0.26
54 0.27
55 0.23
56 0.22
57 0.18
58 0.17
59 0.17
60 0.16
61 0.12
62 0.08
63 0.08
64 0.07
65 0.06
66 0.04
67 0.04
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.06
74 0.07
75 0.09
76 0.09
77 0.1
78 0.12
79 0.12
80 0.11
81 0.11
82 0.1
83 0.08
84 0.07
85 0.06
86 0.04
87 0.04
88 0.05
89 0.04
90 0.06
91 0.06
92 0.06
93 0.1
94 0.12
95 0.14
96 0.16
97 0.19
98 0.21
99 0.23
100 0.25
101 0.22
102 0.2
103 0.18
104 0.16
105 0.14
106 0.11
107 0.1
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.09
114 0.09
115 0.09
116 0.12
117 0.13
118 0.13
119 0.14
120 0.14
121 0.12
122 0.12
123 0.1
124 0.1
125 0.11
126 0.11
127 0.11
128 0.12
129 0.13
130 0.18
131 0.26
132 0.29
133 0.35
134 0.41
135 0.46
136 0.48
137 0.53
138 0.56
139 0.53
140 0.5
141 0.47
142 0.45
143 0.42
144 0.4
145 0.35
146 0.27
147 0.22
148 0.19
149 0.14
150 0.09
151 0.07
152 0.05
153 0.05
154 0.05
155 0.06
156 0.09
157 0.16
158 0.22
159 0.26
160 0.35
161 0.41
162 0.5
163 0.57
164 0.63
165 0.63
166 0.67
167 0.72
168 0.72
169 0.76
170 0.76
171 0.78
172 0.77
173 0.76
174 0.76
175 0.71
176 0.7
177 0.63
178 0.61
179 0.62
180 0.6
181 0.59