Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BLR4

Protein Details
Accession A0A1E3BLR4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-124TKNEAAKKTEKQRKKEIHFPQRKYAIKAHydrophilic
NLS Segment(s)
PositionSequence
86-119PKYTRALRRRLTKNEAAKKTEKQRKKEIHFPQRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTKVKTGQLWGKSKDDLTNQLEELKTELNQLRVQKIAGGASSKTQRIHDVRKSIARVLTVINLNQRAQLRLFYKNKKFLPLDLRPKYTRALRRRLTKNEAAKKTEKQRKKEIHFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.44
4 0.43
5 0.39
6 0.38
7 0.35
8 0.36
9 0.34
10 0.29
11 0.27
12 0.2
13 0.17
14 0.18
15 0.2
16 0.19
17 0.23
18 0.25
19 0.25
20 0.24
21 0.24
22 0.2
23 0.19
24 0.17
25 0.14
26 0.14
27 0.12
28 0.15
29 0.18
30 0.19
31 0.19
32 0.19
33 0.24
34 0.28
35 0.35
36 0.37
37 0.39
38 0.4
39 0.44
40 0.45
41 0.41
42 0.37
43 0.29
44 0.24
45 0.2
46 0.19
47 0.15
48 0.14
49 0.15
50 0.15
51 0.14
52 0.17
53 0.17
54 0.15
55 0.14
56 0.18
57 0.18
58 0.25
59 0.33
60 0.38
61 0.44
62 0.51
63 0.52
64 0.55
65 0.53
66 0.5
67 0.52
68 0.53
69 0.57
70 0.54
71 0.59
72 0.54
73 0.54
74 0.53
75 0.52
76 0.53
77 0.5
78 0.55
79 0.57
80 0.66
81 0.73
82 0.77
83 0.77
84 0.76
85 0.78
86 0.79
87 0.78
88 0.74
89 0.71
90 0.7
91 0.73
92 0.75
93 0.73
94 0.7
95 0.75
96 0.79
97 0.81
98 0.83
99 0.83
100 0.84
101 0.86
102 0.85
103 0.84
104 0.83