Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3B759

Protein Details
Accession A0A1E3B759    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-12KKWSKGK
Subcellular Location(s) cyto_nucl 9.833, cyto 9.5, nucl 9, mito_nucl 8.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPQKKKWSKGKVKDKAQHAVVLEKSTAEKLNKDVQSYRLITVATLVDRLKINGSLARQALADLEERGVIKKVVGHHDLDIYTRAVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.83
4 0.74
5 0.67
6 0.57
7 0.52
8 0.43
9 0.37
10 0.3
11 0.22
12 0.21
13 0.18
14 0.21
15 0.16
16 0.16
17 0.18
18 0.26
19 0.27
20 0.29
21 0.29
22 0.27
23 0.32
24 0.32
25 0.29
26 0.22
27 0.2
28 0.17
29 0.17
30 0.14
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.14
43 0.14
44 0.14
45 0.13
46 0.13
47 0.12
48 0.11
49 0.11
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.11
56 0.1
57 0.09
58 0.12
59 0.16
60 0.22
61 0.24
62 0.25
63 0.25
64 0.28
65 0.28
66 0.27
67 0.24
68 0.19
69 0.16