Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BBB1

Protein Details
Accession A0A1E3BBB1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-53NSDYDRRREQVRRAQKKHREGKRNRCRMLEDBasic
NLS Segment(s)
PositionSequence
29-46RREQVRRAQKKHREGKRN
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14686  bZIP  
Amino Acid Sequences MTESNEGSGPGRELGDLGALGANSDYDRRREQVRRAQKKHREGKRNRCRMLEDELHSLYNAITMAHELRDLRFENKILRDIMSRHSIPVPPDIRQQAPSFAEVTFINNAGHHQLLQVKLPGDENGSYERRTQVPPTSQDIHVPSSPRAGPAKPSNEKRDETCFSKGVISQMGVDFVLSLERPCLFHTRAPGEQEPSGHAISMQGILLSGAPQNLRDHAVWEVPAQQLDKLFELSGCLGLDGYITPVQAWNRIISRFDKTQLFDGRLERLRSSMIPHIKCYGFGALIEEKIFEDLMENTVRDIGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.09
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.11
12 0.13
13 0.16
14 0.2
15 0.23
16 0.32
17 0.39
18 0.48
19 0.55
20 0.64
21 0.71
22 0.77
23 0.85
24 0.86
25 0.9
26 0.9
27 0.9
28 0.89
29 0.89
30 0.92
31 0.92
32 0.92
33 0.87
34 0.82
35 0.76
36 0.69
37 0.67
38 0.64
39 0.57
40 0.52
41 0.48
42 0.43
43 0.37
44 0.34
45 0.25
46 0.17
47 0.13
48 0.07
49 0.06
50 0.07
51 0.08
52 0.08
53 0.1
54 0.1
55 0.1
56 0.15
57 0.17
58 0.17
59 0.19
60 0.21
61 0.25
62 0.27
63 0.3
64 0.27
65 0.26
66 0.27
67 0.26
68 0.29
69 0.3
70 0.27
71 0.25
72 0.27
73 0.28
74 0.26
75 0.33
76 0.31
77 0.26
78 0.32
79 0.33
80 0.32
81 0.33
82 0.33
83 0.29
84 0.28
85 0.27
86 0.23
87 0.19
88 0.19
89 0.15
90 0.17
91 0.12
92 0.12
93 0.11
94 0.1
95 0.11
96 0.11
97 0.11
98 0.08
99 0.09
100 0.11
101 0.12
102 0.13
103 0.14
104 0.13
105 0.14
106 0.14
107 0.13
108 0.12
109 0.12
110 0.12
111 0.15
112 0.16
113 0.16
114 0.17
115 0.18
116 0.19
117 0.2
118 0.21
119 0.23
120 0.26
121 0.29
122 0.33
123 0.35
124 0.33
125 0.34
126 0.34
127 0.31
128 0.27
129 0.25
130 0.2
131 0.2
132 0.19
133 0.19
134 0.19
135 0.16
136 0.19
137 0.24
138 0.31
139 0.35
140 0.4
141 0.44
142 0.47
143 0.48
144 0.46
145 0.47
146 0.42
147 0.4
148 0.37
149 0.32
150 0.28
151 0.28
152 0.26
153 0.2
154 0.17
155 0.14
156 0.11
157 0.1
158 0.1
159 0.08
160 0.07
161 0.06
162 0.05
163 0.05
164 0.04
165 0.04
166 0.05
167 0.05
168 0.06
169 0.08
170 0.12
171 0.14
172 0.15
173 0.21
174 0.25
175 0.27
176 0.31
177 0.32
178 0.3
179 0.3
180 0.29
181 0.25
182 0.24
183 0.21
184 0.16
185 0.14
186 0.11
187 0.1
188 0.1
189 0.08
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.06
197 0.06
198 0.08
199 0.09
200 0.1
201 0.13
202 0.12
203 0.13
204 0.14
205 0.15
206 0.14
207 0.14
208 0.16
209 0.14
210 0.16
211 0.14
212 0.14
213 0.14
214 0.15
215 0.15
216 0.13
217 0.13
218 0.11
219 0.12
220 0.12
221 0.12
222 0.1
223 0.09
224 0.08
225 0.07
226 0.08
227 0.06
228 0.08
229 0.07
230 0.08
231 0.08
232 0.11
233 0.12
234 0.16
235 0.17
236 0.18
237 0.2
238 0.22
239 0.25
240 0.25
241 0.3
242 0.3
243 0.33
244 0.35
245 0.34
246 0.4
247 0.43
248 0.43
249 0.41
250 0.4
251 0.43
252 0.44
253 0.44
254 0.37
255 0.33
256 0.32
257 0.29
258 0.32
259 0.34
260 0.37
261 0.36
262 0.39
263 0.43
264 0.41
265 0.4
266 0.38
267 0.32
268 0.24
269 0.21
270 0.24
271 0.2
272 0.21
273 0.21
274 0.18
275 0.15
276 0.16
277 0.15
278 0.1
279 0.1
280 0.09
281 0.12
282 0.14
283 0.14
284 0.14
285 0.16