Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BJ63

Protein Details
Accession A0A1E3BJ63    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-45TPKVEPQEKKKQPKGRAMKRLKYTRRFVBasic
NLS Segment(s)
PositionSequence
12-41GKVKSATPKVEPQEKKKQPKGRAMKRLKYT
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVEPQEKKKQPKGRAMKRLKYTRRFVNVTMTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.38
4 0.36
5 0.37
6 0.45
7 0.46
8 0.54
9 0.56
10 0.55
11 0.6
12 0.66
13 0.71
14 0.73
15 0.76
16 0.74
17 0.78
18 0.81
19 0.8
20 0.82
21 0.81
22 0.8
23 0.81
24 0.84
25 0.83
26 0.81
27 0.77
28 0.75
29 0.74
30 0.69
31 0.61
32 0.6
33 0.54
34 0.49
35 0.48
36 0.42
37 0.39
38 0.38
39 0.39
40 0.36
41 0.41
42 0.47
43 0.5