Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A0HTB6

Protein Details
Accession A0A0A0HTB6    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDHPRHYCRLKQRQKQQKQQHQHQHQHQHWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
KEGG pbn:PADG_12328  -  
Amino Acid Sequences MDHPRHYCRLKQRQKQQKQQHQHQHQHQHWMPPVRILRRDALFVPITVRRKLAQLSFAAGWTTTGYHHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.93
4 0.92
5 0.92
6 0.92
7 0.93
8 0.92
9 0.91
10 0.89
11 0.88
12 0.8
13 0.79
14 0.71
15 0.66
16 0.6
17 0.56
18 0.47
19 0.42
20 0.44
21 0.37
22 0.38
23 0.34
24 0.33
25 0.29
26 0.3
27 0.25
28 0.24
29 0.21
30 0.19
31 0.2
32 0.22
33 0.24
34 0.23
35 0.24
36 0.21
37 0.23
38 0.26
39 0.26
40 0.25
41 0.22
42 0.26
43 0.25
44 0.25
45 0.23
46 0.19
47 0.17
48 0.14
49 0.13