Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GIM2

Protein Details
Accession C1GIM2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-82DRSELLQRRKREKRLRSDVVQRGBasic
NLS Segment(s)
PositionSequence
67-73RRKREKR
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
KEGG pbn:PADG_07108  -  
Amino Acid Sequences MKRGCQEVRARPTKVCEKRAEKPVNERALRVVDGELCKGDTEAPQDNAEDEAMKGRTMRDRSELLQRRKREKRLRSDVVQRGMSHGSRGWLTMDRGTGWVFMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.64
4 0.64
5 0.69
6 0.77
7 0.78
8 0.71
9 0.72
10 0.73
11 0.73
12 0.66
13 0.59
14 0.51
15 0.45
16 0.41
17 0.32
18 0.24
19 0.18
20 0.18
21 0.18
22 0.15
23 0.12
24 0.12
25 0.11
26 0.11
27 0.09
28 0.11
29 0.14
30 0.15
31 0.15
32 0.15
33 0.15
34 0.15
35 0.14
36 0.1
37 0.07
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.14
44 0.16
45 0.17
46 0.19
47 0.21
48 0.23
49 0.34
50 0.42
51 0.46
52 0.52
53 0.57
54 0.64
55 0.7
56 0.79
57 0.78
58 0.79
59 0.8
60 0.83
61 0.83
62 0.8
63 0.82
64 0.79
65 0.76
66 0.7
67 0.59
68 0.52
69 0.48
70 0.41
71 0.33
72 0.26
73 0.22
74 0.19
75 0.19
76 0.19
77 0.19
78 0.21
79 0.22
80 0.22
81 0.21
82 0.22
83 0.22