Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BS36

Protein Details
Accession A0A1E3BS36   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-108TPANTPKKTPTKRKTPAKGGEDHydrophilic
114-134EESPTKQKKQRTPAKEAKMKEHydrophilic
NLS Segment(s)
PositionSequence
94-105KTPTKRKTPAKG
119-132KQKKQRTPAKEAKM
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSGKAKPEALLGLSASEAKLILMASYLSTDQKVDYEKLAQLGGYKTAASASTLYRNAKRKLAEYIPANLQNSGGGATNTNANTPDATPANTPKKTPTKRKTPAKGGEDGNGAVEESPTKQKKQRTPAKEAKMKEAKDESEPGTPSARPMKMEDELFPYVKLDNGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.08
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.07
13 0.08
14 0.08
15 0.09
16 0.09
17 0.09
18 0.11
19 0.14
20 0.14
21 0.15
22 0.17
23 0.18
24 0.18
25 0.18
26 0.16
27 0.15
28 0.15
29 0.15
30 0.12
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.14
39 0.17
40 0.21
41 0.26
42 0.33
43 0.35
44 0.38
45 0.39
46 0.36
47 0.39
48 0.39
49 0.39
50 0.34
51 0.35
52 0.34
53 0.36
54 0.34
55 0.27
56 0.24
57 0.18
58 0.16
59 0.13
60 0.09
61 0.06
62 0.05
63 0.06
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.09
70 0.08
71 0.1
72 0.08
73 0.1
74 0.1
75 0.16
76 0.23
77 0.23
78 0.24
79 0.28
80 0.38
81 0.45
82 0.55
83 0.57
84 0.61
85 0.7
86 0.8
87 0.82
88 0.82
89 0.83
90 0.76
91 0.74
92 0.64
93 0.57
94 0.48
95 0.4
96 0.3
97 0.21
98 0.17
99 0.11
100 0.09
101 0.07
102 0.07
103 0.16
104 0.18
105 0.22
106 0.27
107 0.36
108 0.44
109 0.55
110 0.63
111 0.62
112 0.7
113 0.76
114 0.81
115 0.8
116 0.74
117 0.74
118 0.72
119 0.65
120 0.61
121 0.57
122 0.49
123 0.45
124 0.47
125 0.4
126 0.37
127 0.37
128 0.32
129 0.3
130 0.28
131 0.28
132 0.32
133 0.3
134 0.27
135 0.29
136 0.33
137 0.35
138 0.37
139 0.34
140 0.33
141 0.35
142 0.34
143 0.31
144 0.26
145 0.22
146 0.21