Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BAY7

Protein Details
Accession A0A1E3BAY7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-50AKAADCHKRTIKRHRSNVRLFGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MAPRLPPSTREMTYGMIVSNELTASQMAKAADCHKRTIKRHRSNVRLFGSVTAPPNKSGRPRSLTPFMVQVLCDHLVEKPHLYLDEMVVFLWDEFEVLVTTWSIRRALKREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.17
4 0.16
5 0.13
6 0.11
7 0.08
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.09
14 0.08
15 0.09
16 0.11
17 0.16
18 0.24
19 0.24
20 0.3
21 0.34
22 0.43
23 0.5
24 0.6
25 0.65
26 0.68
27 0.77
28 0.81
29 0.83
30 0.82
31 0.83
32 0.76
33 0.66
34 0.56
35 0.47
36 0.4
37 0.32
38 0.28
39 0.23
40 0.2
41 0.19
42 0.2
43 0.21
44 0.25
45 0.27
46 0.3
47 0.32
48 0.34
49 0.38
50 0.43
51 0.42
52 0.37
53 0.36
54 0.31
55 0.26
56 0.23
57 0.18
58 0.15
59 0.15
60 0.14
61 0.11
62 0.11
63 0.13
64 0.14
65 0.14
66 0.11
67 0.11
68 0.12
69 0.13
70 0.13
71 0.12
72 0.12
73 0.11
74 0.11
75 0.1
76 0.1
77 0.08
78 0.08
79 0.06
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.09
89 0.11
90 0.14
91 0.17
92 0.24