Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BTD8

Protein Details
Accession A0A1E3BTD8   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-107KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSLRSLLGASTGTLRQFLPQSLSRPTFFSRSFSRLSLANGLRNLRLRSEQKQTQIAGVGARQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.17
5 0.2
6 0.22
7 0.25
8 0.31
9 0.34
10 0.32
11 0.34
12 0.35
13 0.36
14 0.33
15 0.34
16 0.31
17 0.32
18 0.34
19 0.31
20 0.3
21 0.25
22 0.27
23 0.3
24 0.26
25 0.26
26 0.26
27 0.26
28 0.27
29 0.29
30 0.28
31 0.22
32 0.26
33 0.27
34 0.29
35 0.36
36 0.38
37 0.38
38 0.41
39 0.39
40 0.34
41 0.31
42 0.26
43 0.19
44 0.15
45 0.13
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.11
52 0.13
53 0.13
54 0.16
55 0.17
56 0.17
57 0.2
58 0.29
59 0.32
60 0.37
61 0.39
62 0.4
63 0.48
64 0.5
65 0.51
66 0.5
67 0.52
68 0.54
69 0.59
70 0.64
71 0.66
72 0.72
73 0.78
74 0.77
75 0.79
76 0.8
77 0.79
78 0.77
79 0.78
80 0.76
81 0.77
82 0.79
83 0.75
84 0.75
85 0.77
86 0.81
87 0.82