Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BGJ0

Protein Details
Accession A0A1E3BGJ0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-45GSQSAAASRAKRRRKQRGQAEWEVSRHydrophilic
NLS Segment(s)
PositionSequence
28-36RAKRRRKQR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007198  Ssl1-like  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
Pfam View protein in Pfam  
PF04056  Ssl1  
PROSITE View protein in PROSITE  
PS50234  VWFA  
Amino Acid Sequences MADSDEEYIGDVTEDEDLQGSQSAAASRAKRRRKQRGQAEWEVSRTWETLVEGADGTISSTVEGLLEAGKRKRLLRDTTPLQRGIIRHLILVLDLSQSMAEKDLRPTRYLLTIRYAQEFVREFFEQNPISQLGLLGLRDGLAVRISDMSGNPTEHINAIQALRTQDPKGLPSLQNGLEMARGSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.07
6 0.08
7 0.08
8 0.07
9 0.08
10 0.09
11 0.1
12 0.16
13 0.2
14 0.28
15 0.38
16 0.48
17 0.55
18 0.65
19 0.75
20 0.81
21 0.87
22 0.89
23 0.9
24 0.89
25 0.9
26 0.87
27 0.78
28 0.69
29 0.59
30 0.49
31 0.39
32 0.3
33 0.21
34 0.15
35 0.12
36 0.11
37 0.11
38 0.11
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.06
54 0.09
55 0.11
56 0.14
57 0.16
58 0.18
59 0.24
60 0.3
61 0.35
62 0.38
63 0.45
64 0.49
65 0.55
66 0.56
67 0.51
68 0.45
69 0.41
70 0.35
71 0.31
72 0.29
73 0.21
74 0.18
75 0.17
76 0.16
77 0.14
78 0.13
79 0.09
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.11
90 0.17
91 0.18
92 0.19
93 0.21
94 0.21
95 0.27
96 0.27
97 0.24
98 0.23
99 0.27
100 0.27
101 0.28
102 0.28
103 0.21
104 0.24
105 0.24
106 0.21
107 0.2
108 0.2
109 0.18
110 0.18
111 0.25
112 0.21
113 0.2
114 0.21
115 0.17
116 0.16
117 0.15
118 0.14
119 0.09
120 0.1
121 0.09
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.06
131 0.07
132 0.07
133 0.08
134 0.08
135 0.11
136 0.12
137 0.13
138 0.13
139 0.14
140 0.14
141 0.14
142 0.14
143 0.12
144 0.12
145 0.12
146 0.13
147 0.15
148 0.17
149 0.19
150 0.22
151 0.22
152 0.24
153 0.26
154 0.25
155 0.27
156 0.31
157 0.29
158 0.31
159 0.36
160 0.32
161 0.33
162 0.31
163 0.28
164 0.24
165 0.22