Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BQQ9

Protein Details
Accession A0A1E3BQQ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
335-373SASSDRRTRDTRRTRDTRGTRDTRDTRRTRRSRARSGRSBasic
NLS Segment(s)
PositionSequence
352-373RGTRDTRDTRRTRRSRARSGRS
Subcellular Location(s) extr 18, plas 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRAFQLIPAVVSSLVLLSQHAAASPLDMEGGDLDRRGCSNPCGFYSQLCCTSSQTCVTSGGQAVCSDSGSGSGGDYDYHTTTWTETDTKTYTSTWSSQRAGQTAVGGGGSGSSSGSCDSSIGEEQCGSTCCGAAYVCSNGQCIIGSSSIWATATATPPVRGTSSGLSTVTETGNPTTTQAFDTPVNTDGSPAIGVKAPDDDGLSGGAIAGIVIGTIAGVALLLLVCACLCCRGALAGLAACLGIGRKRNNDDHYSQGGKPEGRTWFGAKLPAQSEAGGEKKSRWGGLATIGIVLGALALCLGLKRHRDREHDEKSSYSYPSSYYYYSDYYTNSSSASSDRRTRDTRRTRDTRGTRDTRDTRRTRRSRARSGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.1
12 0.08
13 0.08
14 0.07
15 0.08
16 0.07
17 0.1
18 0.09
19 0.1
20 0.11
21 0.11
22 0.13
23 0.16
24 0.17
25 0.2
26 0.25
27 0.28
28 0.3
29 0.34
30 0.33
31 0.34
32 0.38
33 0.38
34 0.38
35 0.35
36 0.33
37 0.32
38 0.33
39 0.33
40 0.31
41 0.27
42 0.23
43 0.25
44 0.24
45 0.23
46 0.24
47 0.22
48 0.19
49 0.18
50 0.18
51 0.15
52 0.15
53 0.12
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.1
64 0.1
65 0.1
66 0.11
67 0.11
68 0.12
69 0.12
70 0.14
71 0.13
72 0.13
73 0.18
74 0.18
75 0.19
76 0.2
77 0.2
78 0.2
79 0.21
80 0.25
81 0.26
82 0.3
83 0.3
84 0.33
85 0.35
86 0.34
87 0.33
88 0.28
89 0.24
90 0.19
91 0.17
92 0.13
93 0.1
94 0.08
95 0.06
96 0.05
97 0.04
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.08
107 0.11
108 0.11
109 0.11
110 0.11
111 0.11
112 0.12
113 0.13
114 0.11
115 0.09
116 0.08
117 0.08
118 0.08
119 0.08
120 0.07
121 0.08
122 0.09
123 0.11
124 0.11
125 0.12
126 0.11
127 0.11
128 0.11
129 0.1
130 0.09
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.06
139 0.08
140 0.09
141 0.11
142 0.12
143 0.12
144 0.12
145 0.13
146 0.13
147 0.12
148 0.12
149 0.11
150 0.12
151 0.13
152 0.13
153 0.12
154 0.12
155 0.12
156 0.11
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.09
163 0.08
164 0.09
165 0.09
166 0.09
167 0.11
168 0.1
169 0.11
170 0.11
171 0.12
172 0.13
173 0.11
174 0.11
175 0.09
176 0.09
177 0.08
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.05
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.02
197 0.02
198 0.02
199 0.01
200 0.01
201 0.01
202 0.01
203 0.01
204 0.01
205 0.01
206 0.01
207 0.02
208 0.02
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.03
216 0.04
217 0.04
218 0.05
219 0.05
220 0.06
221 0.07
222 0.07
223 0.07
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.06
231 0.11
232 0.14
233 0.19
234 0.24
235 0.3
236 0.35
237 0.4
238 0.41
239 0.42
240 0.45
241 0.45
242 0.41
243 0.38
244 0.37
245 0.33
246 0.3
247 0.29
248 0.26
249 0.24
250 0.26
251 0.25
252 0.25
253 0.25
254 0.3
255 0.25
256 0.28
257 0.27
258 0.27
259 0.25
260 0.21
261 0.21
262 0.19
263 0.21
264 0.18
265 0.17
266 0.16
267 0.21
268 0.23
269 0.22
270 0.2
271 0.19
272 0.18
273 0.22
274 0.23
275 0.17
276 0.16
277 0.15
278 0.13
279 0.12
280 0.1
281 0.06
282 0.03
283 0.02
284 0.02
285 0.02
286 0.02
287 0.03
288 0.05
289 0.1
290 0.18
291 0.25
292 0.34
293 0.42
294 0.5
295 0.58
296 0.67
297 0.72
298 0.72
299 0.67
300 0.6
301 0.59
302 0.56
303 0.49
304 0.4
305 0.31
306 0.25
307 0.27
308 0.28
309 0.23
310 0.21
311 0.23
312 0.24
313 0.25
314 0.25
315 0.22
316 0.23
317 0.24
318 0.22
319 0.19
320 0.17
321 0.17
322 0.19
323 0.23
324 0.26
325 0.32
326 0.36
327 0.43
328 0.5
329 0.57
330 0.64
331 0.69
332 0.73
333 0.76
334 0.79
335 0.8
336 0.84
337 0.86
338 0.85
339 0.85
340 0.83
341 0.79
342 0.81
343 0.82
344 0.81
345 0.82
346 0.82
347 0.82
348 0.84
349 0.87
350 0.88
351 0.9
352 0.9
353 0.91