Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GKD9

Protein Details
Accession C1GKD9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-55RCLGRERYKHAQKNREKARENRKRIEEBasic
NLS Segment(s)
PositionSequence
37-52KHAQKNREKARENRKR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG pbn:PADG_07725  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MTMLDECHARGFLHKALAGCNEIKREVNRCLGRERYKHAQKNREKARENRKRIEEIWRKDDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.24
5 0.24
6 0.21
7 0.21
8 0.2
9 0.19
10 0.21
11 0.22
12 0.24
13 0.25
14 0.32
15 0.33
16 0.33
17 0.36
18 0.41
19 0.45
20 0.44
21 0.47
22 0.48
23 0.55
24 0.61
25 0.65
26 0.68
27 0.7
28 0.78
29 0.81
30 0.81
31 0.78
32 0.8
33 0.83
34 0.83
35 0.83
36 0.82
37 0.78
38 0.75
39 0.71
40 0.72
41 0.71
42 0.69
43 0.68