Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3B8B0

Protein Details
Accession A0A1E3B8B0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
189-220VRGMSRAERKDRIRRNERKMRSNEKKARKGGNBasic
NLS Segment(s)
PositionSequence
102-141KPLPTPKPPTKWELFARKKGIGKYSTKPGAALADKERRKK
190-220RGMSRAERKDRIRRNERKMRSNEKKARKGGN
Subcellular Location(s) nucl 13, mito 6, cyto 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTEVEMASTPTAGADSKPERLPVTVSKPTPYTFDLGHLLANDPNPLELPRDQPLNTSLKSTARDGVQSLLNQLITTCPITSSPQQGVLLTLPPPATALPRHKPLPTPKPPTKWELFARKKGIGKYSTKPGAALADKERRKKLVYDEEKGEWVPRWGYKGKNKNDDDWLVEVDEKDWKKEEDAAAKGSSVRGMSRAERKDRIRRNERKMRSNEKKARKGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.23
4 0.25
5 0.27
6 0.28
7 0.28
8 0.33
9 0.32
10 0.37
11 0.4
12 0.4
13 0.41
14 0.42
15 0.42
16 0.41
17 0.36
18 0.3
19 0.22
20 0.24
21 0.24
22 0.22
23 0.22
24 0.18
25 0.18
26 0.17
27 0.17
28 0.14
29 0.11
30 0.11
31 0.11
32 0.11
33 0.13
34 0.13
35 0.17
36 0.19
37 0.22
38 0.22
39 0.22
40 0.26
41 0.28
42 0.26
43 0.25
44 0.24
45 0.25
46 0.27
47 0.27
48 0.26
49 0.22
50 0.23
51 0.21
52 0.21
53 0.2
54 0.18
55 0.17
56 0.15
57 0.14
58 0.12
59 0.11
60 0.1
61 0.08
62 0.09
63 0.08
64 0.07
65 0.08
66 0.11
67 0.14
68 0.17
69 0.16
70 0.19
71 0.19
72 0.18
73 0.18
74 0.16
75 0.15
76 0.11
77 0.12
78 0.09
79 0.08
80 0.09
81 0.08
82 0.09
83 0.12
84 0.18
85 0.21
86 0.25
87 0.28
88 0.28
89 0.33
90 0.4
91 0.47
92 0.5
93 0.55
94 0.56
95 0.61
96 0.62
97 0.62
98 0.55
99 0.51
100 0.48
101 0.5
102 0.5
103 0.51
104 0.52
105 0.51
106 0.53
107 0.49
108 0.48
109 0.43
110 0.41
111 0.38
112 0.42
113 0.42
114 0.38
115 0.36
116 0.31
117 0.3
118 0.26
119 0.25
120 0.23
121 0.29
122 0.33
123 0.39
124 0.4
125 0.39
126 0.39
127 0.4
128 0.42
129 0.44
130 0.47
131 0.47
132 0.48
133 0.47
134 0.47
135 0.44
136 0.37
137 0.26
138 0.21
139 0.18
140 0.15
141 0.18
142 0.21
143 0.28
144 0.37
145 0.46
146 0.52
147 0.6
148 0.62
149 0.61
150 0.64
151 0.59
152 0.53
153 0.45
154 0.38
155 0.29
156 0.27
157 0.22
158 0.17
159 0.21
160 0.18
161 0.18
162 0.19
163 0.19
164 0.2
165 0.25
166 0.29
167 0.29
168 0.32
169 0.33
170 0.31
171 0.31
172 0.3
173 0.25
174 0.22
175 0.16
176 0.14
177 0.13
178 0.16
179 0.22
180 0.31
181 0.38
182 0.44
183 0.51
184 0.59
185 0.67
186 0.73
187 0.78
188 0.8
189 0.83
190 0.86
191 0.89
192 0.89
193 0.89
194 0.89
195 0.9
196 0.9
197 0.9
198 0.9
199 0.9
200 0.91