Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3BI98

Protein Details
Accession A0A1E3BI98   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-103LSQNRHLARPKKKGIKRQAIVHydrophilic
NLS Segment(s)
PositionSequence
91-99RPKKKGIKR
Subcellular Location(s) extr 16, nucl 4, cyto 3, mito 1, plas 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTYTFASIIQVYLHAAPQYDANKKMGNVGHDDLQSDSDLERGYEPDLEQGEFDNTSDDDSDIGNMNPSPSSHDQHNPVTQPQLSQNRHLARPKKKGIKRQAIVSITVGPTGAAIALALIIYFVGRARGSWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.15
5 0.2
6 0.23
7 0.25
8 0.26
9 0.29
10 0.28
11 0.34
12 0.31
13 0.28
14 0.29
15 0.28
16 0.3
17 0.27
18 0.28
19 0.23
20 0.21
21 0.19
22 0.14
23 0.12
24 0.09
25 0.09
26 0.08
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.11
33 0.12
34 0.11
35 0.11
36 0.11
37 0.11
38 0.1
39 0.1
40 0.08
41 0.07
42 0.07
43 0.08
44 0.07
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.11
56 0.13
57 0.15
58 0.17
59 0.21
60 0.24
61 0.28
62 0.31
63 0.27
64 0.26
65 0.27
66 0.24
67 0.22
68 0.26
69 0.32
70 0.31
71 0.33
72 0.4
73 0.41
74 0.46
75 0.52
76 0.54
77 0.54
78 0.62
79 0.67
80 0.7
81 0.74
82 0.79
83 0.82
84 0.84
85 0.78
86 0.76
87 0.75
88 0.66
89 0.61
90 0.52
91 0.45
92 0.34
93 0.3
94 0.23
95 0.14
96 0.12
97 0.1
98 0.08
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.03
108 0.03
109 0.03
110 0.06
111 0.06