Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BTG7

Protein Details
Accession A0A1E3BTG7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKRNRKTQQIKFKVRCNRFHydrophilic
NLS Segment(s)
PositionSequence
26-27KR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEISRRKDASSARIKRNRKTQQIKFKVRCNRFLYSLVLKDSDKADKLKQSLPPSLKVVDVSKGDKKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.4
4 0.37
5 0.41
6 0.43
7 0.42
8 0.49
9 0.52
10 0.53
11 0.61
12 0.67
13 0.7
14 0.77
15 0.77
16 0.77
17 0.79
18 0.78
19 0.8
20 0.85
21 0.89
22 0.83
23 0.82
24 0.81
25 0.74
26 0.73
27 0.67
28 0.59
29 0.52
30 0.49
31 0.44
32 0.39
33 0.37
34 0.29
35 0.26
36 0.23
37 0.22
38 0.21
39 0.2
40 0.18
41 0.19
42 0.21
43 0.25
44 0.28
45 0.32
46 0.37
47 0.39
48 0.45
49 0.46
50 0.46
51 0.44
52 0.42
53 0.38
54 0.34
55 0.31
56 0.28
57 0.29
58 0.3
59 0.36
60 0.4