Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BNL6

Protein Details
Accession A0A1E3BNL6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-99EKVKKEYEEKQQRKKEKEKEKDGEBasic
NLS Segment(s)
PositionSequence
77-119KVKKEYEEKQQRKKEKEKEKDGESKEKDGKEKKDADKDKDAKS
Subcellular Location(s) nucl 22.5, mito_nucl 13, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSLQNTWHHRKVAETAAKACFICYKPSSSVLITPDNKDFFYICPAHLKDRNFCSPVVDTAGAEAKGKEEALAREIEKVKKEYEEKQQRKKEKEKEKDGESKEKDGKEKKDADKDKDAKSDEKERDDKINSLKKQEKAQGQGQGSTSTDDSPRVFSLHKNFYQMRVDRLRNIEMAKRNRQRLQDPSLFPSVPSGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.45
4 0.47
5 0.43
6 0.38
7 0.34
8 0.28
9 0.3
10 0.28
11 0.3
12 0.29
13 0.33
14 0.35
15 0.3
16 0.33
17 0.3
18 0.36
19 0.34
20 0.35
21 0.36
22 0.35
23 0.33
24 0.3
25 0.27
26 0.2
27 0.24
28 0.22
29 0.18
30 0.24
31 0.26
32 0.32
33 0.36
34 0.38
35 0.38
36 0.44
37 0.49
38 0.43
39 0.41
40 0.38
41 0.34
42 0.33
43 0.3
44 0.24
45 0.17
46 0.17
47 0.19
48 0.16
49 0.15
50 0.13
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.09
57 0.11
58 0.13
59 0.12
60 0.17
61 0.21
62 0.23
63 0.23
64 0.24
65 0.23
66 0.26
67 0.29
68 0.29
69 0.37
70 0.46
71 0.52
72 0.6
73 0.68
74 0.71
75 0.76
76 0.81
77 0.79
78 0.79
79 0.8
80 0.8
81 0.77
82 0.76
83 0.76
84 0.7
85 0.7
86 0.61
87 0.57
88 0.52
89 0.48
90 0.48
91 0.46
92 0.46
93 0.44
94 0.5
95 0.49
96 0.55
97 0.58
98 0.58
99 0.61
100 0.63
101 0.6
102 0.57
103 0.55
104 0.48
105 0.47
106 0.5
107 0.44
108 0.45
109 0.45
110 0.41
111 0.45
112 0.43
113 0.42
114 0.42
115 0.47
116 0.42
117 0.47
118 0.52
119 0.49
120 0.53
121 0.57
122 0.54
123 0.51
124 0.54
125 0.53
126 0.48
127 0.47
128 0.42
129 0.36
130 0.31
131 0.27
132 0.22
133 0.16
134 0.15
135 0.15
136 0.15
137 0.16
138 0.16
139 0.16
140 0.16
141 0.2
142 0.28
143 0.34
144 0.35
145 0.39
146 0.39
147 0.43
148 0.5
149 0.47
150 0.47
151 0.48
152 0.49
153 0.48
154 0.51
155 0.49
156 0.44
157 0.45
158 0.45
159 0.45
160 0.5
161 0.55
162 0.59
163 0.65
164 0.68
165 0.72
166 0.73
167 0.72
168 0.72
169 0.71
170 0.66
171 0.63
172 0.63
173 0.56
174 0.48
175 0.43