Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BU45

Protein Details
Accession A0A1E3BU45    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-128KRITYNPSRRVQKRRHGFLARLRTRGGRKILMRRRARGKKALSBasic
NLS Segment(s)
PositionSequence
94-126RRVQKRRHGFLARLRTRGGRKILMRRRARGKKA
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFCRGTLPALRTSVLRAQTPLTSLNRPFSSLLTSRLSPSLPTTTTTTITPRTTLTSTFTSPLQSPLTSALNSQTRPFSASACLAGKRITYNPSRRVQKRRHGFLARLRTRGGRKILMRRRARGKKALSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.25
4 0.25
5 0.25
6 0.27
7 0.28
8 0.26
9 0.28
10 0.28
11 0.34
12 0.32
13 0.33
14 0.32
15 0.28
16 0.29
17 0.25
18 0.27
19 0.25
20 0.25
21 0.24
22 0.24
23 0.24
24 0.19
25 0.2
26 0.2
27 0.16
28 0.18
29 0.2
30 0.2
31 0.21
32 0.22
33 0.21
34 0.21
35 0.21
36 0.2
37 0.17
38 0.19
39 0.18
40 0.18
41 0.19
42 0.18
43 0.18
44 0.18
45 0.18
46 0.16
47 0.16
48 0.18
49 0.15
50 0.12
51 0.12
52 0.13
53 0.14
54 0.12
55 0.12
56 0.14
57 0.15
58 0.16
59 0.17
60 0.15
61 0.14
62 0.16
63 0.16
64 0.13
65 0.12
66 0.13
67 0.14
68 0.15
69 0.16
70 0.14
71 0.15
72 0.14
73 0.15
74 0.16
75 0.18
76 0.25
77 0.32
78 0.39
79 0.47
80 0.56
81 0.62
82 0.7
83 0.74
84 0.77
85 0.79
86 0.8
87 0.81
88 0.78
89 0.77
90 0.76
91 0.78
92 0.73
93 0.66
94 0.59
95 0.57
96 0.56
97 0.57
98 0.53
99 0.5
100 0.52
101 0.6
102 0.68
103 0.71
104 0.74
105 0.75
106 0.81
107 0.83
108 0.83
109 0.82