Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3BLR3

Protein Details
Accession A0A1E3BLR3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
123-150AYPIEAPKEKKQKTKKDKGSKYPGAAKAHydrophilic
NLS Segment(s)
PositionSequence
128-144APKEKKQKTKKDKGSKY
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 10.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MSSSDPNSKIDLLDLPEVTARKIKKANAPPKELENNGLVSFVEHVLFPASLLLDGERSFKVDREGAEPLVYKGIESLKQDYAADVLTPQLLKPAVNLALRRLLDPIQNEFTSSPEWQEIEKKAYPIEAPKEKKQKTKKDKGSKYPGAAKAEEQAEQGKEPSQATASDVGKSASEAMDMLSVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.22
5 0.22
6 0.24
7 0.21
8 0.24
9 0.29
10 0.34
11 0.41
12 0.51
13 0.6
14 0.63
15 0.69
16 0.65
17 0.68
18 0.69
19 0.6
20 0.52
21 0.44
22 0.38
23 0.31
24 0.28
25 0.2
26 0.14
27 0.14
28 0.11
29 0.1
30 0.07
31 0.07
32 0.08
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.09
43 0.08
44 0.1
45 0.11
46 0.11
47 0.14
48 0.15
49 0.16
50 0.17
51 0.19
52 0.18
53 0.19
54 0.18
55 0.16
56 0.16
57 0.14
58 0.1
59 0.09
60 0.11
61 0.12
62 0.13
63 0.16
64 0.15
65 0.16
66 0.16
67 0.15
68 0.14
69 0.11
70 0.09
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.11
82 0.13
83 0.13
84 0.13
85 0.18
86 0.18
87 0.18
88 0.18
89 0.16
90 0.16
91 0.18
92 0.2
93 0.19
94 0.18
95 0.19
96 0.18
97 0.18
98 0.18
99 0.16
100 0.14
101 0.11
102 0.12
103 0.12
104 0.16
105 0.17
106 0.21
107 0.22
108 0.21
109 0.2
110 0.21
111 0.22
112 0.23
113 0.28
114 0.32
115 0.36
116 0.44
117 0.55
118 0.58
119 0.67
120 0.71
121 0.75
122 0.77
123 0.82
124 0.85
125 0.86
126 0.91
127 0.92
128 0.92
129 0.88
130 0.84
131 0.82
132 0.78
133 0.71
134 0.62
135 0.53
136 0.48
137 0.42
138 0.36
139 0.28
140 0.25
141 0.22
142 0.22
143 0.21
144 0.18
145 0.19
146 0.18
147 0.18
148 0.16
149 0.15
150 0.16
151 0.22
152 0.21
153 0.2
154 0.2
155 0.19
156 0.18
157 0.18
158 0.17
159 0.11
160 0.1
161 0.09
162 0.09